Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 4932675..4933336 | Replicon | chromosome |
Accession | NZ_CP122407 | ||
Organism | Rugamonas sp. DEMB1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | QC826_RS22790 | Protein ID | WP_279762587.1 |
Coordinates | 4933151..4933336 (-) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QC826_RS22785 | Protein ID | WP_093387724.1 |
Coordinates | 4932675..4933088 (-) | Length | 138 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC826_RS22770 (QC826_22770) | 4928312..4931269 | + | 2958 | WP_279762585.1 | heparinase II/III family protein | - |
QC826_RS22775 (QC826_22775) | 4931336..4932310 | - | 975 | WP_093387458.1 | LysR family transcriptional regulator | - |
QC826_RS22780 (QC826_22780) | 4932413..4932610 | + | 198 | WP_279762586.1 | hypothetical protein | - |
QC826_RS22785 (QC826_22785) | 4932675..4933088 | - | 414 | WP_093387724.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QC826_RS22790 (QC826_22790) | 4933151..4933336 | - | 186 | WP_279762587.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QC826_RS22795 (QC826_22795) | 4933690..4934898 | - | 1209 | WP_279762588.1 | MFS transporter | - |
QC826_RS22800 (QC826_22800) | 4934993..4936138 | + | 1146 | WP_279762589.1 | acyltransferase | - |
QC826_RS22805 (QC826_22805) | 4936113..4936895 | - | 783 | WP_279762590.1 | flagellar brake protein | - |
QC826_RS22810 (QC826_22810) | 4937198..4937839 | + | 642 | WP_093387465.1 | uridine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4932675..4941937 | 9262 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6999.08 Da Isoelectric Point: 11.1572
>T276850 WP_279762587.1 NZ_CP122407:c4933336-4933151 [Rugamonas sp. DEMB1]
VKQSEFRRWLGEQGATFKDGTNHLKVYLNGKQTVMPRHPSHEIGERLRQAVLKQLGLKTGK
VKQSEFRRWLGEQGATFKDGTNHLKVYLNGKQTVMPRHPSHEIGERLRQAVLKQLGLKTGK
Download Length: 186 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 14955.28 Da Isoelectric Point: 4.7324
>AT276850 WP_093387724.1 NZ_CP122407:c4933088-4932675 [Rugamonas sp. DEMB1]
MRYPVKIEQDGEGWFASVPAIPEALTSGPSAEAALAMAKDALITSMDFYFEDGRPVPLPGDIAEGEYHVDLPASMWAKVL
LLNEMLAQQKRPTDLARLLGAKLQDVQRLFDLAHPTKIDKVEQALNALGKHLVMAAS
MRYPVKIEQDGEGWFASVPAIPEALTSGPSAEAALAMAKDALITSMDFYFEDGRPVPLPGDIAEGEYHVDLPASMWAKVL
LLNEMLAQQKRPTDLARLLGAKLQDVQRLFDLAHPTKIDKVEQALNALGKHLVMAAS
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|