Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 4781289..4782000 Replicon chromosome
Accession NZ_CP122407
Organism Rugamonas sp. DEMB1

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag QC826_RS22005 Protein ID WP_279762446.1
Coordinates 4781289..4781468 (+) Length 60 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag QC826_RS22010 Protein ID WP_279762447.1
Coordinates 4781581..4782000 (+) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC826_RS21985 (QC826_21985) 4776371..4777006 + 636 WP_279762443.1 TetR/AcrR family transcriptional regulator -
QC826_RS21990 (QC826_21990) 4777107..4777412 + 306 WP_099415829.1 antibiotic biosynthesis monooxygenase family protein -
QC826_RS21995 (QC826_21995) 4777473..4779767 - 2295 WP_279762445.1 bifunctional diguanylate cyclase/phosphodiesterase -
QC826_RS22000 (QC826_22000) 4779933..4781120 - 1188 WP_279766564.1 nicotinate phosphoribosyltransferase -
QC826_RS22005 (QC826_22005) 4781289..4781468 + 180 WP_279762446.1 type II toxin-antitoxin system HicA family toxin Toxin
QC826_RS22010 (QC826_22010) 4781581..4782000 + 420 WP_279762447.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QC826_RS22015 (QC826_22015) 4782107..4782457 - 351 Protein_4317 cysteine hydrolase -
QC826_RS22020 (QC826_22020) 4782894..4783187 - 294 WP_279766565.1 type II toxin-antitoxin system RelE/ParE family toxin -
QC826_RS22025 (QC826_22025) 4783184..4783405 - 222 WP_279762448.1 hypothetical protein -
QC826_RS22030 (QC826_22030) 4783473..4784351 - 879 WP_279762450.1 cysteine hydrolase -
QC826_RS22035 (QC826_22035) 4784470..4785085 - 616 Protein_4321 FMN-dependent NADH-azoreductase -
QC826_RS22040 (QC826_22040) 4785236..4786171 + 936 WP_279762451.1 LysR family transcriptional regulator -
QC826_RS22045 (QC826_22045) 4786245..4786556 - 312 WP_279762452.1 chaperone modulator CbpM -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-58)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-65)


Sequences

Toxin        


Download         Length: 60 a.a.        Molecular weight: 6674.79 Da        Isoelectric Point: 10.6654

>T276849 WP_279762446.1 NZ_CP122407:4781289-4781468 [Rugamonas sp. DEMB1]
MKYSEFRRWLEKQGAVFTPAKGSHHKVSLIGRSTVFPYHGAQEMGTGLVEKIKKDLGLK

Download         Length: 180 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15352.66 Da        Isoelectric Point: 4.9345

>AT276849 WP_279762447.1 NZ_CP122407:4781581-4782000 [Rugamonas sp. DEMB1]
MLNYPVTLVPDTNGTYLVGFPDFPEANSVGDNIEDALKNAVDALESALEIYFDERRPVPAPSAPEPGQHLVALPALETAK
VLLWNEMYAQKVRKADLARMLNVHTPQVDRLFDLKHSSKIEFVEQAAKVLGKTLVVGLK

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References