Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpB-mazE/PRK09812-MazE |
Location | 4302800..4303392 | Replicon | chromosome |
Accession | NZ_CP122407 | ||
Organism | Rugamonas sp. DEMB1 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | - |
Locus tag | QC826_RS19745 | Protein ID | WP_279762085.1 |
Coordinates | 4302800..4303147 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | QC826_RS19750 | Protein ID | WP_279762086.1 |
Coordinates | 4303141..4303392 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC826_RS19715 (QC826_19715) | 4297976..4298155 | - | 180 | WP_279762080.1 | hypothetical protein | - |
QC826_RS19720 (QC826_19720) | 4298294..4298719 | - | 426 | WP_279762081.1 | cupin domain-containing protein | - |
QC826_RS19725 (QC826_19725) | 4298798..4299625 | - | 828 | WP_279762082.1 | AraC family transcriptional regulator | - |
QC826_RS19730 (QC826_19730) | 4299977..4300192 | + | 216 | Protein_3877 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
QC826_RS19735 (QC826_19735) | 4300360..4300752 | + | 393 | WP_279762083.1 | hypothetical protein | - |
QC826_RS19740 (QC826_19740) | 4301372..4302640 | + | 1269 | WP_279762084.1 | hypothetical protein | - |
QC826_RS19745 (QC826_19745) | 4302800..4303147 | - | 348 | WP_279762085.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
QC826_RS19750 (QC826_19750) | 4303141..4303392 | - | 252 | WP_279762086.1 | PbsX family transcriptional regulator | Antitoxin |
QC826_RS19755 (QC826_19755) | 4303605..4304948 | - | 1344 | WP_279762087.1 | HipA domain-containing protein | - |
QC826_RS19760 (QC826_19760) | 4304995..4305411 | - | 417 | WP_279762088.1 | helix-turn-helix domain-containing protein | - |
QC826_RS19765 (QC826_19765) | 4306421..4306756 | - | 336 | WP_279762089.1 | ATP-binding protein | - |
QC826_RS19770 (QC826_19770) | 4306819..4307940 | - | 1122 | WP_279762090.1 | HNH endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4111927..4372166 | 260239 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12196.95 Da Isoelectric Point: 8.9519
>T276848 WP_279762085.1 NZ_CP122407:c4303147-4302800 [Rugamonas sp. DEMB1]
VVSRVKFGRGDIVMVNLDPTEGHEQRGMRPALVLSTSAFNALGVVLVAPITQGGDFSRHAGFAASLSGAGTKTQGVALVN
QVHMLDFEARKARRVETVPESVVDDALARLRAITD
VVSRVKFGRGDIVMVNLDPTEGHEQRGMRPALVLSTSAFNALGVVLVAPITQGGDFSRHAGFAASLSGAGTKTQGVALVN
QVHMLDFEARKARRVETVPESVVDDALARLRAITD
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|