Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
| Location | 4279594..4280255 | Replicon | chromosome |
| Accession | NZ_CP122407 | ||
| Organism | Rugamonas sp. DEMB1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QC826_RS19625 | Protein ID | WP_279762064.1 |
| Coordinates | 4279594..4280007 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QC826_RS19630 | Protein ID | WP_279762065.1 |
| Coordinates | 4280004..4280255 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC826_RS19590 (QC826_19590) | 4275043..4275873 | - | 831 | WP_279762057.1 | baseplate J/gp47 family protein | - |
| QC826_RS19595 (QC826_19595) | 4275870..4276202 | - | 333 | WP_279762058.1 | GPW/gp25 family protein | - |
| QC826_RS19600 (QC826_19600) | 4276205..4276399 | - | 195 | WP_279762059.1 | hypothetical protein | - |
| QC826_RS19605 (QC826_19605) | 4276588..4277184 | - | 597 | WP_279762060.1 | phage baseplate assembly protein V | - |
| QC826_RS19610 (QC826_19610) | 4277194..4277727 | - | 534 | WP_279762061.1 | hypothetical protein | - |
| QC826_RS19615 (QC826_19615) | 4277952..4278653 | - | 702 | WP_279762062.1 | hypothetical protein | - |
| QC826_RS19620 (QC826_19620) | 4278821..4279501 | + | 681 | WP_279762063.1 | XRE family transcriptional regulator | - |
| QC826_RS19625 (QC826_19625) | 4279594..4280007 | - | 414 | WP_279762064.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QC826_RS19630 (QC826_19630) | 4280004..4280255 | - | 252 | WP_279762065.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QC826_RS19635 (QC826_19635) | 4280361..4280555 | - | 195 | WP_279762066.1 | hypothetical protein | - |
| QC826_RS19640 (QC826_19640) | 4280609..4282540 | - | 1932 | WP_279762067.1 | EAL domain-containing protein | - |
| QC826_RS19645 (QC826_19645) | 4282539..4282730 | + | 192 | WP_279762068.1 | hypothetical protein | - |
| QC826_RS19650 (QC826_19650) | 4282755..4284206 | - | 1452 | WP_279762069.1 | ATPase domain-containing protein | - |
| QC826_RS19655 (QC826_19655) | 4284203..4284607 | - | 405 | WP_279762070.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 4111927..4372166 | 260239 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15113.47 Da Isoelectric Point: 7.0134
>T276847 WP_279762064.1 NZ_CP122407:c4280007-4279594 [Rugamonas sp. DEMB1]
MSYLLDTNVLSELRRKMPNSVVLDWMARRPAATLYLSVLTLGELRKGVEGVNDPIRRANLLDWLENELPAFFAGRILAVD
AQVADRWGRMVAAAGRPVPAIDSLIGATAAHYGLSLVTRNARDFTDLGLDVINPWTP
MSYLLDTNVLSELRRKMPNSVVLDWMARRPAATLYLSVLTLGELRKGVEGVNDPIRRANLLDWLENELPAFFAGRILAVD
AQVADRWGRMVAAAGRPVPAIDSLIGATAAHYGLSLVTRNARDFTDLGLDVINPWTP
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|