Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 2919024..2919620 | Replicon | chromosome |
| Accession | NZ_CP122401 | ||
| Organism | Enterobacter roggenkampii strain EOBSR_19 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A0F1DED9 |
| Locus tag | QCD67_RS14285 | Protein ID | WP_023293553.1 |
| Coordinates | 2919024..2919326 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | W7P674 |
| Locus tag | QCD67_RS14290 | Protein ID | WP_021242718.1 |
| Coordinates | 2919333..2919620 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCD67_RS14265 (QCD67_14265) | 2915006..2916580 | + | 1575 | WP_008503417.1 | RNA repair transcriptional activator RtcR | - |
| QCD67_RS14270 (QCD67_14270) | 2916686..2917630 | + | 945 | WP_023293551.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
| QCD67_RS14275 (QCD67_14275) | 2917681..2917953 | + | 273 | WP_014830263.1 | DUF3811 domain-containing protein | - |
| QCD67_RS14280 (QCD67_14280) | 2917954..2918826 | - | 873 | WP_008503414.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| QCD67_RS14285 (QCD67_14285) | 2919024..2919326 | + | 303 | WP_023293553.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QCD67_RS14290 (QCD67_14290) | 2919333..2919620 | + | 288 | WP_021242718.1 | putative addiction module antidote protein | Antitoxin |
| QCD67_RS14295 (QCD67_14295) | 2919617..2921248 | - | 1632 | WP_008503411.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11459.24 Da Isoelectric Point: 10.1771
>T276837 WP_023293553.1 NZ_CP122401:2919024-2919326 [Enterobacter roggenkampii]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDVKPVGEGISELRIHFGPGYRIYFKDQGNYIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDVKPVGEGISELRIHFGPGYRIYFKDQGNYIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0F1DED9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | W7P674 |