Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2115300..2115920 | Replicon | chromosome |
Accession | NZ_CP122401 | ||
Organism | Enterobacter roggenkampii strain EOBSR_19 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A1H8SI38 |
Locus tag | QCD67_RS10515 | Protein ID | WP_008499287.1 |
Coordinates | 2115702..2115920 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V3PBI9 |
Locus tag | QCD67_RS10510 | Protein ID | WP_008499288.1 |
Coordinates | 2115300..2115674 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCD67_RS10500 (QCD67_10500) | 2110428..2111621 | + | 1194 | WP_021241633.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QCD67_RS10505 (QCD67_10505) | 2111644..2114790 | + | 3147 | WP_008499289.1 | multidrug efflux RND transporter permease subunit AcrB | - |
QCD67_RS10510 (QCD67_10510) | 2115300..2115674 | + | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
QCD67_RS10515 (QCD67_10515) | 2115702..2115920 | + | 219 | WP_008499287.1 | HHA domain-containing protein | Toxin |
QCD67_RS10520 (QCD67_10520) | 2116127..2116678 | + | 552 | WP_206805139.1 | maltose O-acetyltransferase | - |
QCD67_RS10525 (QCD67_10525) | 2116796..2117263 | + | 468 | WP_008499285.1 | YlaC family protein | - |
QCD67_RS10530 (QCD67_10530) | 2117235..2118695 | - | 1461 | WP_234099619.1 | PLP-dependent aminotransferase family protein | - |
QCD67_RS10535 (QCD67_10535) | 2118797..2119507 | + | 711 | WP_023343500.1 | GNAT family protein | - |
QCD67_RS10540 (QCD67_10540) | 2119504..2119644 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
QCD67_RS10545 (QCD67_10545) | 2119647..2119907 | - | 261 | WP_006176933.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T276836 WP_008499287.1 NZ_CP122401:2115702-2115920 [Enterobacter roggenkampii]
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT276836 WP_008499288.1 NZ_CP122401:2115300-2115674 [Enterobacter roggenkampii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H8SI38 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3PBI9 |