Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 267071..267707 | Replicon | chromosome |
Accession | NZ_CP122397 | ||
Organism | Rossellomorea sp. DA94 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A366ENG2 |
Locus tag | P8596_RS01475 | Protein ID | WP_034763063.1 |
Coordinates | 267357..267707 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A0V8H6B8 |
Locus tag | P8596_RS01470 | Protein ID | WP_032085355.1 |
Coordinates | 267071..267352 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8596_RS01450 (P8596_01450) | 263206..263790 | - | 585 | WP_279725591.1 | rhomboid family intramembrane serine protease | - |
P8596_RS01455 (P8596_01455) | 263926..264276 | + | 351 | WP_279725593.1 | holo-ACP synthase | - |
P8596_RS01460 (P8596_01460) | 264488..265501 | + | 1014 | WP_279725594.1 | outer membrane lipoprotein carrier protein LolA | - |
P8596_RS01465 (P8596_01465) | 265739..266944 | + | 1206 | WP_279725596.1 | alanine racemase | - |
P8596_RS01470 (P8596_01470) | 267071..267352 | + | 282 | WP_032085355.1 | YlcI/YnfO family protein | Antitoxin |
P8596_RS01475 (P8596_01475) | 267357..267707 | + | 351 | WP_034763063.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
P8596_RS01480 (P8596_01480) | 268113..268943 | + | 831 | WP_224521611.1 | RsbT co-antagonist protein RsbRA | - |
P8596_RS01485 (P8596_01485) | 268940..269296 | + | 357 | WP_034763058.1 | STAS domain-containing protein | - |
P8596_RS01490 (P8596_01490) | 269299..269700 | + | 402 | WP_034763056.1 | anti-sigma regulatory factor | - |
P8596_RS01495 (P8596_01495) | 269711..270721 | + | 1011 | WP_224521610.1 | PP2C family protein-serine/threonine phosphatase | - |
P8596_RS01500 (P8596_01500) | 270796..271128 | + | 333 | WP_224521609.1 | anti-sigma factor antagonist | - |
P8596_RS01505 (P8596_01505) | 271128..271595 | + | 468 | WP_034763252.1 | anti-sigma B factor RsbW | - |
P8596_RS01510 (P8596_01510) | 271573..272370 | + | 798 | WP_224521608.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13005.05 Da Isoelectric Point: 5.1554
>T276831 WP_034763063.1 NZ_CP122397:267357-267707 [Rossellomorea sp. DA94]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTIIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDDALQISVGLIQF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTIIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDDALQISVGLIQF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366ENG2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V8H6B8 |