Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 88183..88826 | Replicon | plasmid pKP9650-2 |
| Accession | NZ_CP122391 | ||
| Organism | Klebsiella pneumoniae strain KP9650 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | QCB43_RS28325 | Protein ID | WP_016236302.1 |
| Coordinates | 88183..88599 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | QCB43_RS28330 | Protein ID | WP_001261282.1 |
| Coordinates | 88596..88826 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCB43_RS28305 (QCB43_28305) | 83551..83901 | + | 351 | WP_004187110.1 | DUF305 domain-containing protein | - |
| QCB43_RS28310 (QCB43_28310) | 84087..84995 | - | 909 | WP_032439686.1 | HNH endonuclease | - |
| QCB43_RS28315 (QCB43_28315) | 85540..86562 | - | 1023 | WP_032439672.1 | helicase UvrD | - |
| QCB43_RS28320 (QCB43_28320) | 86547..88109 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
| QCB43_RS28325 (QCB43_28325) | 88183..88599 | - | 417 | WP_016236302.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QCB43_RS28330 (QCB43_28330) | 88596..88826 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QCB43_RS28335 (QCB43_28335) | 88783..89205 | + | 423 | WP_050485703.1 | hypothetical protein | - |
| QCB43_RS28340 (QCB43_28340) | 89405..90349 | + | 945 | WP_032448293.1 | hypothetical protein | - |
| QCB43_RS28345 (QCB43_28345) | 90458..90850 | + | 393 | WP_074422814.1 | hypothetical protein | - |
| QCB43_RS28350 (QCB43_28350) | 90908..91429 | + | 522 | WP_032448294.1 | hypothetical protein | - |
| QCB43_RS28355 (QCB43_28355) | 91475..92260 | + | 786 | WP_050485696.1 | site-specific integrase | - |
| QCB43_RS28360 (QCB43_28360) | 92380..92595 | - | 216 | WP_129586912.1 | hypothetical protein | - |
| QCB43_RS28365 (QCB43_28365) | 92642..93817 | - | 1176 | Protein_97 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(3')-Ia / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / qnrB4 / blaDHA-15 / mph(A) / floR / aph(6)-Id / aph(3'')-Ib / sul2 / tet(A) | iucA / iucB / iucC / iucD / iutA | 1..273266 | 273266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15091.55 Da Isoelectric Point: 7.1084
>T276830 WP_016236302.1 NZ_CP122391:c88599-88183 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|