Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 88183..88826 Replicon plasmid pKP9650-2
Accession NZ_CP122391
Organism Klebsiella pneumoniae strain KP9650

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag QCB43_RS28325 Protein ID WP_016236302.1
Coordinates 88183..88599 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag QCB43_RS28330 Protein ID WP_001261282.1
Coordinates 88596..88826 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QCB43_RS28305 (QCB43_28305) 83551..83901 + 351 WP_004187110.1 DUF305 domain-containing protein -
QCB43_RS28310 (QCB43_28310) 84087..84995 - 909 WP_032439686.1 HNH endonuclease -
QCB43_RS28315 (QCB43_28315) 85540..86562 - 1023 WP_032439672.1 helicase UvrD -
QCB43_RS28320 (QCB43_28320) 86547..88109 - 1563 WP_004206609.1 AAA family ATPase -
QCB43_RS28325 (QCB43_28325) 88183..88599 - 417 WP_016236302.1 type II toxin-antitoxin system VapC family toxin Toxin
QCB43_RS28330 (QCB43_28330) 88596..88826 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QCB43_RS28335 (QCB43_28335) 88783..89205 + 423 WP_050485703.1 hypothetical protein -
QCB43_RS28340 (QCB43_28340) 89405..90349 + 945 WP_032448293.1 hypothetical protein -
QCB43_RS28345 (QCB43_28345) 90458..90850 + 393 WP_074422814.1 hypothetical protein -
QCB43_RS28350 (QCB43_28350) 90908..91429 + 522 WP_032448294.1 hypothetical protein -
QCB43_RS28355 (QCB43_28355) 91475..92260 + 786 WP_050485696.1 site-specific integrase -
QCB43_RS28360 (QCB43_28360) 92380..92595 - 216 WP_129586912.1 hypothetical protein -
QCB43_RS28365 (QCB43_28365) 92642..93817 - 1176 Protein_97 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(3')-Ia / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / qnrB4 / blaDHA-15 / mph(A) / floR / aph(6)-Id / aph(3'')-Ib / sul2 / tet(A) iucA / iucB / iucC / iucD / iutA 1..273266 273266


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15091.55 Da        Isoelectric Point: 7.1084

>T276830 WP_016236302.1 NZ_CP122391:c88599-88183 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT276830 WP_001261282.1 NZ_CP122391:c88826-88596 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References