Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 43182..43918 | Replicon | plasmid pKP9650-2 |
| Accession | NZ_CP122391 | ||
| Organism | Klebsiella pneumoniae strain KP9650 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A8T5ZF70 |
| Locus tag | QCB43_RS28105 | Protein ID | WP_004187044.1 |
| Coordinates | 43182..43664 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | QCB43_RS28110 | Protein ID | WP_003026799.1 |
| Coordinates | 43652..43918 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCB43_RS28080 (QCB43_28080) | 39713..40649 | - | 937 | Protein_40 | ISNCY family transposase | - |
| QCB43_RS28085 (QCB43_28085) | 40759..40908 | + | 150 | Protein_41 | transposase | - |
| QCB43_RS28090 (QCB43_28090) | 40924..41034 | + | 111 | Protein_42 | IS3 family transposase | - |
| QCB43_RS28095 (QCB43_28095) | 41182..41580 | - | 399 | WP_032422684.1 | helix-turn-helix domain-containing protein | - |
| QCB43_RS28100 (QCB43_28100) | 41629..42975 | - | 1347 | WP_077254728.1 | ISNCY family transposase | - |
| QCB43_RS28105 (QCB43_28105) | 43182..43664 | - | 483 | WP_004187044.1 | GNAT family N-acetyltransferase | Toxin |
| QCB43_RS28110 (QCB43_28110) | 43652..43918 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| QCB43_RS28115 (QCB43_28115) | 45030..45839 | - | 810 | WP_023329017.1 | N-formylglutamate deformylase | - |
| QCB43_RS28120 (QCB43_28120) | 45832..47040 | - | 1209 | WP_032448288.1 | imidazolonepropionase | - |
| QCB43_RS28125 (QCB43_28125) | 47052..48446 | - | 1395 | WP_032439652.1 | cytosine permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(3')-Ia / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / qnrB4 / blaDHA-15 / mph(A) / floR / aph(6)-Id / aph(3'')-Ib / sul2 / tet(A) | iucA / iucB / iucC / iucD / iutA | 1..273266 | 273266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17280.93 Da Isoelectric Point: 8.7197
>T276829 WP_004187044.1 NZ_CP122391:c43664-43182 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|