Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5315214..5315839 | Replicon | chromosome |
Accession | NZ_CP122389 | ||
Organism | Klebsiella pneumoniae strain KP9650 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A483GDF6 |
Locus tag | QCB43_RS25945 | Protein ID | WP_004187928.1 |
Coordinates | 5315214..5315597 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | QCB43_RS25950 | Protein ID | WP_004150355.1 |
Coordinates | 5315597..5315839 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCB43_RS25930 (QCB43_25930) | 5312580..5313482 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
QCB43_RS25935 (QCB43_25935) | 5313479..5314114 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
QCB43_RS25940 (QCB43_25940) | 5314111..5315040 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
QCB43_RS25945 (QCB43_25945) | 5315214..5315597 | - | 384 | WP_004187928.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QCB43_RS25950 (QCB43_25950) | 5315597..5315839 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
QCB43_RS25955 (QCB43_25955) | 5316033..5316950 | + | 918 | WP_004187929.1 | alpha/beta hydrolase | - |
QCB43_RS25960 (QCB43_25960) | 5316964..5317905 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
QCB43_RS25965 (QCB43_25965) | 5317950..5318387 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
QCB43_RS25970 (QCB43_25970) | 5318384..5319244 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
QCB43_RS25975 (QCB43_25975) | 5319238..5319837 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14407.64 Da Isoelectric Point: 7.3178
>T276827 WP_004187928.1 NZ_CP122389:c5315597-5315214 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFTGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFTGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483GDF6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |