Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4828777..4829293 | Replicon | chromosome |
Accession | NZ_CP122389 | ||
Organism | Klebsiella pneumoniae strain KP9650 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | QCB43_RS23630 | Protein ID | WP_004178374.1 |
Coordinates | 4828777..4829061 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | QCB43_RS23635 | Protein ID | WP_002886901.1 |
Coordinates | 4829051..4829293 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCB43_RS23605 (QCB43_23605) | 4824167..4824430 | - | 264 | WP_025987940.1 | PTS sugar transporter subunit IIB | - |
QCB43_RS23610 (QCB43_23610) | 4824560..4824733 | + | 174 | WP_019725541.1 | hypothetical protein | - |
QCB43_RS23615 (QCB43_23615) | 4824736..4825479 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
QCB43_RS23620 (QCB43_23620) | 4825836..4827974 | + | 2139 | WP_023301366.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QCB43_RS23625 (QCB43_23625) | 4828309..4828773 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QCB43_RS23630 (QCB43_23630) | 4828777..4829061 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QCB43_RS23635 (QCB43_23635) | 4829051..4829293 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QCB43_RS23640 (QCB43_23640) | 4829371..4831281 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
QCB43_RS23645 (QCB43_23645) | 4831304..4832458 | - | 1155 | WP_023301365.1 | lactonase family protein | - |
QCB43_RS23650 (QCB43_23650) | 4832525..4833265 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T276825 WP_004178374.1 NZ_CP122389:c4829061-4828777 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |