Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yfjZ-ypjF/CbtA-CbeA
Location 4742335..4743005 Replicon chromosome
Accession NZ_CP122389
Organism Klebsiella pneumoniae strain KP9650

Toxin (Protein)


Gene name ypjF Uniprot ID A0A483GLH7
Locus tag QCB43_RS23235 Protein ID WP_023301398.1
Coordinates 4742335..4742667 (-) Length 111 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID A0A483GII7
Locus tag QCB43_RS23240 Protein ID WP_023301397.1
Coordinates 4742688..4743005 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QCB43_RS23210 (QCB43_23210) 4737560..4738232 + 673 Protein_4550 DUF4400 domain-containing protein -
QCB43_RS23215 (QCB43_23215) 4738243..4739127 + 885 WP_004192285.1 RES domain-containing protein -
QCB43_RS23220 (QCB43_23220) 4739326..4739514 - 189 Protein_4552 transposase -
QCB43_RS23225 (QCB43_23225) 4739531..4740642 - 1112 Protein_4553 IS3 family transposase -
QCB43_RS23230 (QCB43_23230) 4741041..4741901 - 861 WP_023301399.1 hypothetical protein -
QCB43_RS23235 (QCB43_23235) 4742335..4742667 - 333 WP_023301398.1 TA system toxin CbtA family protein Toxin
QCB43_RS23240 (QCB43_23240) 4742688..4743005 - 318 WP_023301397.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QCB43_RS23245 (QCB43_23245) 4743024..4743245 - 222 WP_023301396.1 DUF987 domain-containing protein -
QCB43_RS23250 (QCB43_23250) 4743254..4743736 - 483 WP_023301395.1 RadC family protein -
QCB43_RS23255 (QCB43_23255) 4743745..4744203 - 459 WP_023301394.1 antirestriction protein -
QCB43_RS23260 (QCB43_23260) 4744289..4744525 - 237 WP_032446575.1 DUF905 domain-containing protein -
QCB43_RS23265 (QCB43_23265) 4744603..4745013 - 411 WP_023301393.1 hypothetical protein -
QCB43_RS23270 (QCB43_23270) 4745080..4745517 - 438 WP_023301392.1 hypothetical protein -
QCB43_RS23275 (QCB43_23275) 4745559..4746095 - 537 WP_023301391.1 DUF4339 domain-containing protein -
QCB43_RS23280 (QCB43_23280) 4746121..4746831 - 711 WP_023301390.1 DeoR family transcriptional regulator -
QCB43_RS23285 (QCB43_23285) 4747040..4747864 - 825 WP_023301389.1 DUF932 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4731405..4770462 39057


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-101)

Antitoxin

Antitoxin CbeA

(5-104)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12610.65 Da        Isoelectric Point: 5.6692

>T276824 WP_023301398.1 NZ_CP122389:c4742667-4742335 [Klebsiella pneumoniae]
MKTLPATTPQTAKLCLTSADTWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIPLADAVNFLVDKYALVRIDRRGL
SWQEQSSYLRLVDTQRTIKVIELWLFGVMM

Download         Length: 333 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11785.37 Da        Isoelectric Point: 6.6277

>AT276824 WP_023301397.1 NZ_CP122389:c4743005-4742688 [Klebsiella pneumoniae]
MSNITWGLQRDITPCLGSRLVQEGNRLHYLADRASITGKFSDAESLKLDVVFPHFISQMESMLTTGEMNPRHAHCVTLYH
NGFTCEADTLGSSGYVYIAVYLTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A483GLH7

Antitoxin

Source ID Structure
AlphaFold DB A0A483GII7

References