Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4097127..4097746 | Replicon | chromosome |
Accession | NZ_CP122389 | ||
Organism | Klebsiella pneumoniae strain KP9650 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | QCB43_RS20110 | Protein ID | WP_002892050.1 |
Coordinates | 4097528..4097746 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | QCB43_RS20105 | Protein ID | WP_002892066.1 |
Coordinates | 4097127..4097501 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCB43_RS20095 (QCB43_20095) | 4092279..4093472 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QCB43_RS20100 (QCB43_20100) | 4093495..4096641 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
QCB43_RS20105 (QCB43_20105) | 4097127..4097501 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
QCB43_RS20110 (QCB43_20110) | 4097528..4097746 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
QCB43_RS20115 (QCB43_20115) | 4097909..4098475 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
QCB43_RS20120 (QCB43_20120) | 4098447..4098587 | - | 141 | WP_004147370.1 | hypothetical protein | - |
QCB43_RS20125 (QCB43_20125) | 4098608..4099078 | + | 471 | WP_002892026.1 | YlaC family protein | - |
QCB43_RS20130 (QCB43_20130) | 4099053..4100504 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
QCB43_RS20135 (QCB43_20135) | 4100605..4101303 | + | 699 | WP_002892021.1 | GNAT family protein | - |
QCB43_RS20140 (QCB43_20140) | 4101300..4101440 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
QCB43_RS20145 (QCB43_20145) | 4101440..4101703 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T276822 WP_002892050.1 NZ_CP122389:4097528-4097746 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT276822 WP_002892066.1 NZ_CP122389:4097127-4097501 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |