Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4097127..4097746 Replicon chromosome
Accession NZ_CP122389
Organism Klebsiella pneumoniae strain KP9650

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QCB43_RS20110 Protein ID WP_002892050.1
Coordinates 4097528..4097746 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QCB43_RS20105 Protein ID WP_002892066.1
Coordinates 4097127..4097501 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QCB43_RS20095 (QCB43_20095) 4092279..4093472 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QCB43_RS20100 (QCB43_20100) 4093495..4096641 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QCB43_RS20105 (QCB43_20105) 4097127..4097501 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QCB43_RS20110 (QCB43_20110) 4097528..4097746 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QCB43_RS20115 (QCB43_20115) 4097909..4098475 + 567 WP_002892030.1 maltose O-acetyltransferase -
QCB43_RS20120 (QCB43_20120) 4098447..4098587 - 141 WP_004147370.1 hypothetical protein -
QCB43_RS20125 (QCB43_20125) 4098608..4099078 + 471 WP_002892026.1 YlaC family protein -
QCB43_RS20130 (QCB43_20130) 4099053..4100504 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QCB43_RS20135 (QCB43_20135) 4100605..4101303 + 699 WP_002892021.1 GNAT family protein -
QCB43_RS20140 (QCB43_20140) 4101300..4101440 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QCB43_RS20145 (QCB43_20145) 4101440..4101703 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T276822 WP_002892050.1 NZ_CP122389:4097528-4097746 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT276822 WP_002892066.1 NZ_CP122389:4097127-4097501 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References