Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 324174..324760 Replicon chromosome
Accession NZ_CP122389
Organism Klebsiella pneumoniae strain KP9650

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag QCB43_RS01505 Protein ID WP_002920800.1
Coordinates 324392..324760 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag QCB43_RS01500 Protein ID WP_004174006.1
Coordinates 324174..324395 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QCB43_RS01480 (QCB43_01480) 320331..321257 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QCB43_RS01485 (QCB43_01485) 321254..322531 + 1278 WP_023301317.1 branched chain amino acid ABC transporter permease LivM -
QCB43_RS01490 (QCB43_01490) 322528..323295 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QCB43_RS01495 (QCB43_01495) 323297..324010 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QCB43_RS01500 (QCB43_01500) 324174..324395 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QCB43_RS01505 (QCB43_01505) 324392..324760 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QCB43_RS01510 (QCB43_01510) 325033..326349 + 1317 WP_023301316.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QCB43_RS01515 (QCB43_01515) 326456..327343 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QCB43_RS01520 (QCB43_01520) 327340..328185 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QCB43_RS01525 (QCB43_01525) 328187..329257 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 321254..329994 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T276812 WP_002920800.1 NZ_CP122389:324392-324760 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT276812 WP_004174006.1 NZ_CP122389:324174-324395 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References