Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 3437810..3438441 | Replicon | chromosome |
Accession | NZ_CP122328 | ||
Organism | Pantoea agglomerans pv. betae strain 4188 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | A7P61_RS20620 | Protein ID | WP_074399960.1 |
Coordinates | 3438262..3438441 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | A7P61_RS20615 | Protein ID | WP_064703402.1 |
Coordinates | 3437810..3438235 (-) | Length | 142 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7P61_RS20600 (A7P61_20600) | 3434650..3435507 | - | 858 | WP_064703404.1 | MBL fold metallo-hydrolase | - |
A7P61_RS20605 (A7P61_20605) | 3435594..3436103 | - | 510 | WP_039391324.1 | phenolic acid decarboxylase | - |
A7P61_RS20610 (A7P61_20610) | 3436209..3437108 | + | 900 | WP_064703403.1 | LysR family transcriptional regulator | - |
A7P61_RS20615 (A7P61_20615) | 3437810..3438235 | - | 426 | WP_064703402.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
A7P61_RS20620 (A7P61_20620) | 3438262..3438441 | - | 180 | WP_074399960.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
A7P61_RS20625 (A7P61_20625) | 3438624..3440048 | - | 1425 | WP_010253950.1 | dihydrolipoyl dehydrogenase | - |
A7P61_RS20630 (A7P61_20630) | 3440209..3442110 | - | 1902 | WP_039386527.1 | pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6526.63 Da Isoelectric Point: 11.0668
>T276808 WP_074399960.1 NZ_CP122328:c3438441-3438262 [Pantoea agglomerans pv. betae]
MDSSTLISEMKADGWVLTRINGSPHHFTHPTKPGLVTVPHPKKDLPIGTVKSIRKQARI
MDSSTLISEMKADGWVLTRINGSPHHFTHPTKPGLVTVPHPKKDLPIGTVKSIRKQARI
Download Length: 180 bp
Antitoxin
Download Length: 142 a.a. Molecular weight: 15385.49 Da Isoelectric Point: 4.5232
>AT276808 WP_064703402.1 NZ_CP122328:c3438235-3437810 [Pantoea agglomerans pv. betae]
MFYPIAIEAGDHENAYGVTVPDLPGCFSAGDTLDEAIKNAKEAITGHIELCVELGHEIPAVSTIEALAANPDYQDYIWAL
VDVDVIRLLGGSEKINVTLPRSLIDRIDRCVASHPEYKSRSGFLAQVALERITAPINRPQK
MFYPIAIEAGDHENAYGVTVPDLPGCFSAGDTLDEAIKNAKEAITGHIELCVELGHEIPAVSTIEALAANPDYQDYIWAL
VDVDVIRLLGGSEKINVTLPRSLIDRIDRCVASHPEYKSRSGFLAQVALERITAPINRPQK
Download Length: 426 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|