Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3176034..3176651 | Replicon | chromosome |
Accession | NZ_CP122328 | ||
Organism | Pantoea agglomerans pv. betae strain 4188 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | E0LTU7 |
Locus tag | A7P61_RS19370 | Protein ID | WP_003850458.1 |
Coordinates | 3176436..3176651 (+) | Length | 72 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | E0LTU8 |
Locus tag | A7P61_RS19365 | Protein ID | WP_003850455.1 |
Coordinates | 3176034..3176411 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7P61_RS19335 (A7P61_19335) | 3172327..3172581 | + | 255 | WP_010671219.1 | type B 50S ribosomal protein L31 | - |
A7P61_RS19340 (A7P61_19340) | 3172593..3172733 | + | 141 | WP_010255896.1 | type B 50S ribosomal protein L36 | - |
A7P61_RS19345 (A7P61_19345) | 3172779..3173657 | - | 879 | WP_064704602.1 | metal ABC transporter substrate-binding protein | - |
A7P61_RS19350 (A7P61_19350) | 3173673..3174512 | - | 840 | WP_010255890.1 | metal ABC transporter permease | - |
A7P61_RS19355 (A7P61_19355) | 3174509..3175177 | - | 669 | WP_064704851.1 | ABC transporter ATP-binding protein | - |
A7P61_RS19360 (A7P61_19360) | 3175533..3175886 | + | 354 | WP_010255885.1 | hypothetical protein | - |
A7P61_RS19365 (A7P61_19365) | 3176034..3176411 | + | 378 | WP_003850455.1 | Hha toxicity modulator TomB | Antitoxin |
A7P61_RS19370 (A7P61_19370) | 3176436..3176651 | + | 216 | WP_003850458.1 | HHA domain-containing protein | Toxin |
A7P61_RS19380 (A7P61_19380) | 3177058..3177369 | + | 312 | WP_031592174.1 | MGMT family protein | - |
A7P61_RS19385 (A7P61_19385) | 3177409..3177966 | - | 558 | WP_010255881.1 | YbaY family lipoprotein | - |
A7P61_RS19390 (A7P61_19390) | 3178157..3179020 | + | 864 | WP_010255880.1 | acyl-CoA thioesterase II | - |
A7P61_RS19395 (A7P61_19395) | 3179071..3180357 | - | 1287 | WP_010255877.1 | ammonium transporter AmtB | - |
A7P61_RS19400 (A7P61_19400) | 3180392..3180730 | - | 339 | WP_003850469.1 | P-II family nitrogen regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 72 a.a. Molecular weight: 8510.90 Da Isoelectric Point: 9.4825
>T276807 WP_003850458.1 NZ_CP122328:3176436-3176651 [Pantoea agglomerans pv. betae]
MNKTLTKTDYLMRLRRCRSLDTLERVIEKNKYELPEDELAVFYSAADHRLAELTMNKLYDKVPGSVWKFVR
MNKTLTKTDYLMRLRRCRSLDTLERVIEKNKYELPEDELAVFYSAADHRLAELTMNKLYDKVPGSVWKFVR
Download Length: 216 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14636.25 Da Isoelectric Point: 4.3976
>AT276807 WP_003850455.1 NZ_CP122328:3176034-3176411 [Pantoea agglomerans pv. betae]
MDEYSPKRHDIAQLKYLCESLFDDSMATLTDSHHGWVNDPTSESNLQLNDLIEHIASFTMNYKIKHVEDEALISQIDEYL
DDTFMLFSNYGVNSPDLQRWQRSAKRLFNLFTEECAFLQQPSHSL
MDEYSPKRHDIAQLKYLCESLFDDSMATLTDSHHGWVNDPTSESNLQLNDLIEHIASFTMNYKIKHVEDEALISQIDEYL
DDTFMLFSNYGVNSPDLQRWQRSAKRLFNLFTEECAFLQQPSHSL
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1I5AGC3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1I5AG55 |