Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3176034..3176651 Replicon chromosome
Accession NZ_CP122328
Organism Pantoea agglomerans pv. betae strain 4188

Toxin (Protein)


Gene name Hha Uniprot ID E0LTU7
Locus tag A7P61_RS19370 Protein ID WP_003850458.1
Coordinates 3176436..3176651 (+) Length 72 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID E0LTU8
Locus tag A7P61_RS19365 Protein ID WP_003850455.1
Coordinates 3176034..3176411 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A7P61_RS19335 (A7P61_19335) 3172327..3172581 + 255 WP_010671219.1 type B 50S ribosomal protein L31 -
A7P61_RS19340 (A7P61_19340) 3172593..3172733 + 141 WP_010255896.1 type B 50S ribosomal protein L36 -
A7P61_RS19345 (A7P61_19345) 3172779..3173657 - 879 WP_064704602.1 metal ABC transporter substrate-binding protein -
A7P61_RS19350 (A7P61_19350) 3173673..3174512 - 840 WP_010255890.1 metal ABC transporter permease -
A7P61_RS19355 (A7P61_19355) 3174509..3175177 - 669 WP_064704851.1 ABC transporter ATP-binding protein -
A7P61_RS19360 (A7P61_19360) 3175533..3175886 + 354 WP_010255885.1 hypothetical protein -
A7P61_RS19365 (A7P61_19365) 3176034..3176411 + 378 WP_003850455.1 Hha toxicity modulator TomB Antitoxin
A7P61_RS19370 (A7P61_19370) 3176436..3176651 + 216 WP_003850458.1 HHA domain-containing protein Toxin
A7P61_RS19380 (A7P61_19380) 3177058..3177369 + 312 WP_031592174.1 MGMT family protein -
A7P61_RS19385 (A7P61_19385) 3177409..3177966 - 558 WP_010255881.1 YbaY family lipoprotein -
A7P61_RS19390 (A7P61_19390) 3178157..3179020 + 864 WP_010255880.1 acyl-CoA thioesterase II -
A7P61_RS19395 (A7P61_19395) 3179071..3180357 - 1287 WP_010255877.1 ammonium transporter AmtB -
A7P61_RS19400 (A7P61_19400) 3180392..3180730 - 339 WP_003850469.1 P-II family nitrogen regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(12-68)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 72 a.a.        Molecular weight: 8510.90 Da        Isoelectric Point: 9.4825

>T276807 WP_003850458.1 NZ_CP122328:3176436-3176651 [Pantoea agglomerans pv. betae]
MNKTLTKTDYLMRLRRCRSLDTLERVIEKNKYELPEDELAVFYSAADHRLAELTMNKLYDKVPGSVWKFVR

Download         Length: 216 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 14636.25 Da        Isoelectric Point: 4.3976

>AT276807 WP_003850455.1 NZ_CP122328:3176034-3176411 [Pantoea agglomerans pv. betae]
MDEYSPKRHDIAQLKYLCESLFDDSMATLTDSHHGWVNDPTSESNLQLNDLIEHIASFTMNYKIKHVEDEALISQIDEYL
DDTFMLFSNYGVNSPDLQRWQRSAKRLFNLFTEECAFLQQPSHSL

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1I5AGC3

Antitoxin

Source ID Structure
AlphaFold DB A0A1I5AG55

References