Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 642178..642770 | Replicon | chromosome |
Accession | NZ_CP122328 | ||
Organism | Pantoea agglomerans pv. betae strain 4188 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | A7P61_RS07295 | Protein ID | WP_029519675.1 |
Coordinates | 642178..642432 (+) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | A7P61_RS07300 | Protein ID | WP_064704018.1 |
Coordinates | 642429..642770 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7P61_RS07265 (A7P61_07265) | 637366..637728 | + | 363 | WP_064704023.1 | DUF5405 family protein | - |
A7P61_RS07270 (A7P61_07270) | 637725..638588 | + | 864 | WP_064704022.1 | DNA adenine methylase | - |
A7P61_RS07275 (A7P61_07275) | 638585..640831 | + | 2247 | WP_064704021.1 | replication endonuclease | - |
A7P61_RS07280 (A7P61_07280) | 641036..641227 | + | 192 | WP_064704020.1 | hypothetical protein | - |
A7P61_RS07285 (A7P61_07285) | 641243..641479 | + | 237 | WP_223812774.1 | DinI family protein | - |
A7P61_RS07290 (A7P61_07290) | 641554..641811 | + | 258 | WP_064704019.1 | hypothetical protein | - |
A7P61_RS07295 (A7P61_07295) | 642178..642432 | + | 255 | WP_029519675.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
A7P61_RS07300 (A7P61_07300) | 642429..642770 | + | 342 | WP_064704018.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
A7P61_RS07305 (A7P61_07305) | 642866..643846 | + | 981 | WP_064704017.1 | hypothetical protein | - |
A7P61_RS07310 (A7P61_07310) | 643875..644915 | - | 1041 | WP_064704016.1 | phage portal protein | - |
A7P61_RS07315 (A7P61_07315) | 644915..646678 | - | 1764 | WP_064704015.1 | terminase ATPase subunit family protein | - |
A7P61_RS07320 (A7P61_07320) | 646823..647671 | + | 849 | WP_064704014.1 | GPO family capsid scaffolding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | rfaE | 630966..701115 | 70149 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9481.99 Da Isoelectric Point: 11.3526
>T276803 WP_029519675.1 NZ_CP122328:642178-642432 [Pantoea agglomerans pv. betae]
MNKRHQKTLSDVFARPVSGSIKWSDIESLFIALGAEVHEREGSRIAVLLKGQKKIFHRPHPRPTTDKGAVNSIRVWLDSL
GIRP
MNKRHQKTLSDVFARPVSGSIKWSDIESLFIALGAEVHEREGSRIAVLLKGQKKIFHRPHPRPTTDKGAVNSIRVWLDSL
GIRP
Download Length: 255 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 12505.13 Da Isoelectric Point: 4.4886
>AT276803 WP_064704018.1 NZ_CP122328:642429-642770 [Pantoea agglomerans pv. betae]
MNNTLKIDGHLAVITFDPEIEMFRGEFVGLNGGADFYAYSVEELKKEGSTSLAVFLDECRKDDIEPYKTFSGKVTTRLTP
ERHQALAVTAQAHGVSINELLNEGVDLVIEKLS
MNNTLKIDGHLAVITFDPEIEMFRGEFVGLNGGADFYAYSVEELKKEGSTSLAVFLDECRKDDIEPYKTFSGKVTTRLTP
ERHQALAVTAQAHGVSINELLNEGVDLVIEKLS
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|