Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 1002..2038 | Replicon | plasmid pPATHpab |
Accession | NZ_CP122327 | ||
Organism | Pantoea agglomerans pv. betae strain 4188 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | A7P61_RS03375 | Protein ID | WP_064691088.1 |
Coordinates | 1463..2038 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | A0A501RV39 |
Locus tag | A7P61_RS03370 | Protein ID | WP_064691087.1 |
Coordinates | 1002..1463 (+) | Length | 154 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7P61_RS03370 (A7P61_03370) | 1002..1463 | + | 462 | WP_064691087.1 | helix-turn-helix domain-containing protein | Antitoxin |
A7P61_RS03375 (A7P61_03375) | 1463..2038 | + | 576 | WP_064691088.1 | PIN domain-containing protein | Toxin |
A7P61_RS03380 (A7P61_03380) | 2198..2602 | - | 405 | WP_155740503.1 | hypothetical protein | - |
A7P61_RS03385 (A7P61_03385) | 2580..3248 | - | 669 | WP_064703434.1 | recombinase family protein | - |
A7P61_RS03390 (A7P61_03390) | 3967..4449 | + | 483 | WP_064703435.1 | zeta toxin family protein | - |
A7P61_RS03395 (A7P61_03395) | 4626..5734 | + | 1109 | Protein_6 | IS3 family transposase | - |
A7P61_RS03400 (A7P61_03400) | 5768..5869 | - | 102 | Protein_7 | 3'-5' exonuclease | - |
A7P61_RS03405 (A7P61_03405) | 6178..6843 | + | 666 | Protein_8 | chemotaxis protein | - |
A7P61_RS03410 (A7P61_03410) | 6843..7013 | - | 171 | Protein_9 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla | 1..156057 | 156057 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21525.78 Da Isoelectric Point: 4.4863
>T276801 WP_064691088.1 NZ_CP122327:1463-2038 [Pantoea agglomerans pv. betae]
MNHTPYPVVLDACVLYPSFLRDLLIRLGLTGLYQPKWSATIEDEWQRNLLANRTDLTPEQIQRTAALMNTAVPDAMITGF
EPLIDSVDLPDVDDRHVVAASVRSNSEIIVTFNLKDFPAPALNAFGIEALHPDDFVMDLFDLNRALVLSAVTTQRSNLRR
PPMSVDEYLEALLRQGMAQTVKELSMYRLLI
MNHTPYPVVLDACVLYPSFLRDLLIRLGLTGLYQPKWSATIEDEWQRNLLANRTDLTPEQIQRTAALMNTAVPDAMITGF
EPLIDSVDLPDVDDRHVVAASVRSNSEIIVTFNLKDFPAPALNAFGIEALHPDDFVMDLFDLNRALVLSAVTTQRSNLRR
PPMSVDEYLEALLRQGMAQTVKELSMYRLLI
Download Length: 576 bp
Antitoxin
Download Length: 154 a.a. Molecular weight: 16949.47 Da Isoelectric Point: 5.9939
>AT276801 WP_064691087.1 NZ_CP122327:1002-1463 [Pantoea agglomerans pv. betae]
MTNSILDSLSLPAKGEIEAAVRGQRELAAYLSTKMETQKIAIQDADNITHQIELPTSSLTLLMSILGELALGNAVQVVPV
HAELTTQEAANILNVSRPHMVKLLEDGKLPFHKTGRHRRVLFADLMKYKDQRDSESNKAMQELADLSQELGLY
MTNSILDSLSLPAKGEIEAAVRGQRELAAYLSTKMETQKIAIQDADNITHQIELPTSSLTLLMSILGELALGNAVQVVPV
HAELTTQEAANILNVSRPHMVKLLEDGKLPFHKTGRHRRVLFADLMKYKDQRDSESNKAMQELADLSQELGLY
Download Length: 462 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|