Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 75626..76161 | Replicon | plasmid pPAB03 |
| Accession | NZ_CP122326 | ||
| Organism | Pantoea agglomerans pv. betae strain 4188 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A8X8DPA1 |
| Locus tag | A7P61_RS02920 | Protein ID | WP_010257115.1 |
| Coordinates | 75874..76161 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | A7P61_RS02915 | Protein ID | WP_064703455.1 |
| Coordinates | 75626..75877 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A7P61_RS02895 (A7P61_02895) | 71233..71502 | - | 270 | WP_064703451.1 | DUF1471 family periplasmic protein YahO | - |
| A7P61_RS02900 (A7P61_02900) | 71775..72911 | - | 1137 | WP_064703452.1 | HlyD family secretion protein | - |
| A7P61_RS02905 (A7P61_02905) | 72913..73239 | - | 327 | WP_064703453.1 | DUF3302 domain-containing protein | - |
| A7P61_RS02910 (A7P61_02910) | 73833..75485 | + | 1653 | WP_064703454.1 | intermembrane transport protein PqiB | - |
| A7P61_RS02915 (A7P61_02915) | 75626..75877 | + | 252 | WP_064703455.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| A7P61_RS02920 (A7P61_02920) | 75874..76161 | + | 288 | WP_010257115.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| A7P61_RS02925 (A7P61_02925) | 76524..76838 | + | 315 | WP_031593845.1 | hypothetical protein | - |
| A7P61_RS02930 (A7P61_02930) | 76835..77653 | - | 819 | WP_064703456.1 | DUF4225 domain-containing protein | - |
| A7P61_RS02935 (A7P61_02935) | 77989..78684 | + | 696 | WP_064703457.1 | haloacid dehalogenase type II | - |
| A7P61_RS02940 (A7P61_02940) | 78722..80251 | - | 1530 | WP_064703458.1 | Fic family protein | - |
| A7P61_RS02945 (A7P61_02945) | 80398..80763 | - | 366 | WP_064703459.1 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF | - |
| A7P61_RS02950 (A7P61_02950) | 80760..81080 | - | 321 | WP_022624286.1 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..178621 | 178621 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11173.08 Da Isoelectric Point: 10.3856
>T276800 WP_010257115.1 NZ_CP122326:75874-76161 [Pantoea agglomerans pv. betae]
VSYTVKFREEAFKEWQKLDKSLQQQFAKKLKKCCDNPHIPSARLRGIKDCYKIKLRASGFRLVYQVIDDQLVIAVVAVGK
RERSDVYHLASERMR
VSYTVKFREEAFKEWQKLDKSLQQQFAKKLKKCCDNPHIPSARLRGIKDCYKIKLRASGFRLVYQVIDDQLVIAVVAVGK
RERSDVYHLASERMR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|