Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 31098..31624 | Replicon | plasmid pPAB03 |
Accession | NZ_CP122326 | ||
Organism | Pantoea agglomerans pv. betae strain 4188 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | A7P61_RS02715 | Protein ID | WP_031593074.1 |
Coordinates | 31098..31385 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | A7P61_RS02720 | Protein ID | WP_064703129.1 |
Coordinates | 31385..31624 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7P61_RS02690 (A7P61_02690) | 26998..28023 | - | 1026 | WP_031593079.1 | alpha/beta hydrolase | - |
A7P61_RS02695 (A7P61_02695) | 28092..29216 | - | 1125 | WP_081273776.1 | MFS transporter | - |
A7P61_RS02700 (A7P61_02700) | 29419..30315 | + | 897 | WP_064703127.1 | LysR family transcriptional regulator | - |
A7P61_RS02705 (A7P61_02705) | 30379..30555 | - | 177 | WP_074399946.1 | general stress protein | - |
A7P61_RS02710 (A7P61_02710) | 30757..31053 | + | 297 | WP_064703128.1 | hypothetical protein | - |
A7P61_RS02715 (A7P61_02715) | 31098..31385 | - | 288 | WP_031593074.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
A7P61_RS02720 (A7P61_02720) | 31385..31624 | - | 240 | WP_064703129.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
A7P61_RS02725 (A7P61_02725) | 31965..33938 | + | 1974 | WP_064703130.1 | methyl-accepting chemotaxis protein | - |
A7P61_RS02730 (A7P61_02730) | 34043..35059 | + | 1017 | WP_039387390.1 | NAD(P)-dependent alcohol dehydrogenase | - |
A7P61_RS02735 (A7P61_02735) | 35109..35777 | - | 669 | WP_064703131.1 | DUF2268 domain-containing putative Zn-dependent protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..178621 | 178621 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11039.97 Da Isoelectric Point: 10.2591
>T276799 WP_031593074.1 NZ_CP122326:c31385-31098 [Pantoea agglomerans pv. betae]
MPWQLECDQRALKEWRKLGPTVREQLKKKLAECLESPRIEANKLSRMPDCYKIKLKSSGYRLAYQVIDDRVVVFVVAVGK
RERSEVCSAASRRLS
MPWQLECDQRALKEWRKLGPTVREQLKKKLAECLESPRIEANKLSRMPDCYKIKLKSSGYRLAYQVIDDRVVVFVVAVGK
RERSEVCSAASRRLS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|