Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 14235..15271 | Replicon | plasmid pPATHpag |
Accession | NZ_CP122323 | ||
Organism | Pantoea agglomerans pv. gypsophilae strain 824-1 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | A7P62_RS22850 | Protein ID | WP_064691088.1 |
Coordinates | 14696..15271 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | A0A501RV39 |
Locus tag | A7P62_RS22845 | Protein ID | WP_064691087.1 |
Coordinates | 14235..14696 (+) | Length | 154 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7P62_RS22830 (A7P62_22830) | 10400..12019 | + | 1620 | WP_231113951.1 | integrating conjugative element protein | - |
A7P62_RS22835 (A7P62_22835) | 12016..12399 | + | 384 | WP_081276239.1 | hypothetical protein | - |
A7P62_RS22840 (A7P62_22840) | 12399..13907 | + | 1509 | WP_064691086.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
A7P62_RS22845 (A7P62_22845) | 14235..14696 | + | 462 | WP_064691087.1 | helix-turn-helix domain-containing protein | Antitoxin |
A7P62_RS22850 (A7P62_22850) | 14696..15271 | + | 576 | WP_064691088.1 | PIN domain-containing protein | Toxin |
A7P62_RS22855 (A7P62_22855) | 15306..15776 | - | 471 | WP_196766611.1 | hypothetical protein | - |
A7P62_RS22860 (A7P62_22860) | 16091..16327 | + | 237 | Protein_17 | DNA polymerase V subunit UmuC | - |
A7P62_RS22865 (A7P62_22865) | 16309..16671 | - | 363 | WP_196766613.1 | hypothetical protein | - |
A7P62_RS22870 (A7P62_22870) | 16913..18379 | - | 1467 | WP_032490486.1 | hypothetical protein | - |
A7P62_RS22875 (A7P62_22875) | 18867..19531 | + | 665 | Protein_20 | chemotaxis protein | - |
A7P62_RS22880 (A7P62_22880) | 19531..19701 | - | 171 | Protein_21 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla | 1..131449 | 131449 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21525.78 Da Isoelectric Point: 4.4863
>T276797 WP_064691088.1 NZ_CP122323:14696-15271 [Pantoea agglomerans pv. gypsophilae]
MNHTPYPVVLDACVLYPSFLRDLLIRLGLTGLYQPKWSATIEDEWQRNLLANRTDLTPEQIQRTAALMNTAVPDAMITGF
EPLIDSVDLPDVDDRHVVAASVRSNSEIIVTFNLKDFPAPALNAFGIEALHPDDFVMDLFDLNRALVLSAVTTQRSNLRR
PPMSVDEYLEALLRQGMAQTVKELSMYRLLI
MNHTPYPVVLDACVLYPSFLRDLLIRLGLTGLYQPKWSATIEDEWQRNLLANRTDLTPEQIQRTAALMNTAVPDAMITGF
EPLIDSVDLPDVDDRHVVAASVRSNSEIIVTFNLKDFPAPALNAFGIEALHPDDFVMDLFDLNRALVLSAVTTQRSNLRR
PPMSVDEYLEALLRQGMAQTVKELSMYRLLI
Download Length: 576 bp
Antitoxin
Download Length: 154 a.a. Molecular weight: 16949.47 Da Isoelectric Point: 5.9939
>AT276797 WP_064691087.1 NZ_CP122323:14235-14696 [Pantoea agglomerans pv. gypsophilae]
MTNSILDSLSLPAKGEIEAAVRGQRELAAYLSTKMETQKIAIQDADNITHQIELPTSSLTLLMSILGELALGNAVQVVPV
HAELTTQEAANILNVSRPHMVKLLEDGKLPFHKTGRHRRVLFADLMKYKDQRDSESNKAMQELADLSQELGLY
MTNSILDSLSLPAKGEIEAAVRGQRELAAYLSTKMETQKIAIQDADNITHQIELPTSSLTLLMSILGELALGNAVQVVPV
HAELTTQEAANILNVSRPHMVKLLEDGKLPFHKTGRHRRVLFADLMKYKDQRDSESNKAMQELADLSQELGLY
Download Length: 462 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|