Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 97402..97937 Replicon plasmid pPAG03
Accession NZ_CP122322
Organism Pantoea agglomerans pv. gypsophilae strain 824-1

Toxin (Protein)


Gene name relE Uniprot ID A0A8X8DPA1
Locus tag A7P62_RS22565 Protein ID WP_010257115.1
Coordinates 97402..97689 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A379LU84
Locus tag A7P62_RS22570 Protein ID WP_022624281.1
Coordinates 97686..97937 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A7P62_RS22525 (A7P62_22525) 93361..93681 + 321 WP_010257131.1 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE -
A7P62_RS22530 (A7P62_22530) 93678..94043 + 366 WP_064689846.1 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF -
A7P62_RS22535 (A7P62_22535) 94148..94363 - 216 Protein_79 HAD hydrolase-like protein -
A7P62_RS22540 (A7P62_22540) 94520..94794 + 275 Protein_80 SAM-dependent DNA methyltransferase -
A7P62_RS22545 (A7P62_22545) 94913..95245 + 333 WP_031292300.1 type II toxin-antitoxin system RelE/ParE family toxin -
A7P62_RS22550 (A7P62_22550) 95242..95532 + 291 WP_022624282.1 XRE family transcriptional regulator -
A7P62_RS22555 (A7P62_22555) 95910..96728 + 819 WP_064689844.1 DUF4225 domain-containing protein -
A7P62_RS22560 (A7P62_22560) 96725..97039 - 315 WP_033759977.1 hypothetical protein -
A7P62_RS22565 (A7P62_22565) 97402..97689 - 288 WP_010257115.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
A7P62_RS22570 (A7P62_22570) 97686..97937 - 252 WP_022624281.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
A7P62_RS22575 (A7P62_22575) 98078..99730 - 1653 WP_064689843.1 intermembrane transport protein PqiB -
A7P62_RS22580 (A7P62_22580) 100325..100651 + 327 WP_064689842.1 DUF3302 domain-containing protein -
A7P62_RS22585 (A7P62_22585) 100653..101789 + 1137 WP_022624279.1 HlyD family secretion protein -
A7P62_RS22590 (A7P62_22590) 102065..102334 + 270 WP_010257103.1 DUF1471 family periplasmic protein YahO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..143524 143524


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11173.08 Da        Isoelectric Point: 10.3856

>T276795 WP_010257115.1 NZ_CP122322:c97689-97402 [Pantoea agglomerans pv. gypsophilae]
VSYTVKFREEAFKEWQKLDKSLQQQFAKKLKKCCDNPHIPSARLRGIKDCYKIKLRASGFRLVYQVIDDQLVIAVVAVGK
RERSDVYHLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9081.35 Da        Isoelectric Point: 3.9507

>AT276795 WP_022624281.1 NZ_CP122322:c97937-97686 [Pantoea agglomerans pv. gypsophilae]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYEQMLDALDDQELVKLVSERSGQRLLDVDLD
ALL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A379LU84

References