Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1991470..1992087 Replicon chromosome
Accession NZ_CP122320
Organism Pantoea agglomerans pv. gypsophilae strain 824-1

Toxin (Protein)


Gene name Hha Uniprot ID E0LTU7
Locus tag A7P62_RS09365 Protein ID WP_003850458.1
Coordinates 1991470..1991685 (-) Length 72 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID E0LTU8
Locus tag A7P62_RS09370 Protein ID WP_003850455.1
Coordinates 1991710..1992087 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A7P62_RS09335 (1987392) 1987392..1987730 + 339 WP_003850469.1 P-II family nitrogen regulator -
A7P62_RS09340 (1987765) 1987765..1989051 + 1287 WP_010255877.1 ammonium transporter AmtB -
A7P62_RS09345 (1989101) 1989101..1989964 - 864 WP_045140707.1 acyl-CoA thioesterase II -
A7P62_RS09350 (1990155) 1990155..1990712 + 558 WP_010255881.1 YbaY family lipoprotein -
A7P62_RS09355 (1990752) 1990752..1991063 - 312 WP_031293095.1 MGMT family protein -
A7P62_RS09365 (1991470) 1991470..1991685 - 216 WP_003850458.1 HHA domain-containing protein Toxin
A7P62_RS09370 (1991710) 1991710..1992087 - 378 WP_003850455.1 Hha toxicity modulator TomB Antitoxin
A7P62_RS09375 (1992235) 1992235..1992588 - 354 WP_010255885.1 hypothetical protein -
A7P62_RS09380 (1992930) 1992930..1993598 + 669 WP_033766689.1 ABC transporter ATP-binding protein -
A7P62_RS09385 (1993595) 1993595..1994434 + 840 WP_010671217.1 metal ABC transporter permease -
A7P62_RS09390 (1994450) 1994450..1995328 + 879 WP_010671218.1 metal ABC transporter substrate-binding protein -
A7P62_RS09395 (1995374) 1995374..1995514 - 141 WP_010255896.1 type B 50S ribosomal protein L36 -
A7P62_RS09400 (1995526) 1995526..1995780 - 255 WP_010671219.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(12-68)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 72 a.a.        Molecular weight: 8510.90 Da        Isoelectric Point: 9.4825

>T276786 WP_003850458.1 NZ_CP122320:c1991685-1991470 [Pantoea agglomerans pv. gypsophilae]
MNKTLTKTDYLMRLRRCRSLDTLERVIEKNKYELPEDELAVFYSAADHRLAELTMNKLYDKVPGSVWKFVR

Download         Length: 216 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 14636.25 Da        Isoelectric Point: 4.3976

>AT276786 WP_003850455.1 NZ_CP122320:c1992087-1991710 [Pantoea agglomerans pv. gypsophilae]
MDEYSPKRHDIAQLKYLCESLFDDSMATLTDSHHGWVNDPTSESNLQLNDLIEHIASFTMNYKIKHVEDEALISQIDEYL
DDTFMLFSNYGVNSPDLQRWQRSAKRLFNLFTEECAFLQQPSHSL

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1I5AGC3

Antitoxin

Source ID Structure
AlphaFold DB A0A1I5AG55

References