Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1727880..1728511 | Replicon | chromosome |
| Accession | NZ_CP122320 | ||
| Organism | Pantoea agglomerans pv. gypsophilae strain 824-1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7X5MR53 |
| Locus tag | A7P62_RS08105 | Protein ID | WP_010253953.1 |
| Coordinates | 1727880..1728059 (+) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | A7P62_RS08110 | Protein ID | WP_064691099.1 |
| Coordinates | 1728086..1728511 (+) | Length | 142 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A7P62_RS08095 (1724211) | 1724211..1726112 | + | 1902 | WP_064691097.1 | pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase | - |
| A7P62_RS08100 (1726273) | 1726273..1727697 | + | 1425 | WP_064691098.1 | dihydrolipoyl dehydrogenase | - |
| A7P62_RS08105 (1727880) | 1727880..1728059 | + | 180 | WP_010253953.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| A7P62_RS08110 (1728086) | 1728086..1728511 | + | 426 | WP_064691099.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| A7P62_RS08115 (1728565) | 1728565..1728682 | + | 118 | Protein_1560 | subtype I-E CRISPR-associated endonuclease Cas1 | - |
| A7P62_RS08120 (1728919) | 1728919..1729860 | + | 942 | WP_064691101.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| A7P62_RS08125 (1730289) | 1730289..1731188 | - | 900 | WP_060679463.1 | LysR family transcriptional regulator | - |
| A7P62_RS08130 (1731294) | 1731294..1731803 | + | 510 | WP_039391324.1 | phenolic acid decarboxylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6467.52 Da Isoelectric Point: 10.7891
>T276785 WP_010253953.1 NZ_CP122320:1727880-1728059 [Pantoea agglomerans pv. gypsophilae]
MDSSTLISEMKADGWVLTGINGSHHHFTHPTKPGLVTVPHPKKDLPIGTVKSIRKQARI
MDSSTLISEMKADGWVLTGINGSHHHFTHPTKPGLVTVPHPKKDLPIGTVKSIRKQARI
Download Length: 180 bp
Antitoxin
Download Length: 142 a.a. Molecular weight: 15452.67 Da Isoelectric Point: 4.7754
>AT276785 WP_064691099.1 NZ_CP122320:1728086-1728511 [Pantoea agglomerans pv. gypsophilae]
MFYPIAIEAGDHEHAYGVIVPDLPGCFSAGDTLDEAIKNAKEAITGHIELCVELGHEIPAVSTIETLATNLEYQGYIWAL
VDVDVIRLLGGSEKINVTLPRSLIDRIDRCVASHPEYKSRSGFLAQVALERITAPINRPQK
MFYPIAIEAGDHEHAYGVIVPDLPGCFSAGDTLDEAIKNAKEAITGHIELCVELGHEIPAVSTIETLATNLEYQGYIWAL
VDVDVIRLLGGSEKINVTLPRSLIDRIDRCVASHPEYKSRSGFLAQVALERITAPINRPQK
Download Length: 426 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|