Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4512187..4513018 | Replicon | chromosome |
| Accession | NZ_CP122319 | ||
| Organism | Escherichia coli strain BW25113 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | QCG47_RS22035 | Protein ID | WP_000854814.1 |
| Coordinates | 4512644..4513018 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | QCG47_RS22030 | Protein ID | WP_001285584.1 |
| Coordinates | 4512187..4512555 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCG47_RS22015 (4509854) | 4509854..4511386 | + | 1533 | WP_001350525.1 | protein YeeR | - |
| QCG47_RS22020 (4511383) | 4511383..4511829 | + | 447 | WP_000187523.1 | RadC family protein | - |
| QCG47_RS22025 (4511892) | 4511892..4512113 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QCG47_RS22030 (4512187) | 4512187..4512555 | + | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QCG47_RS22035 (4512644) | 4512644..4513018 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QCG47_RS22040 (4513015) | 4513015..4513209 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| QCG47_RS22045 (4513255) | 4513255..4513335 | + | 81 | Protein_4286 | hypothetical protein | - |
| QCG47_RS22050 (4513624) | 4513624..4513752 | - | 129 | Protein_4287 | transposase domain-containing protein | - |
| QCG47_RS22055 (4513872) | 4513872..4514006 | + | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| QCG47_RS22060 (4514107) | 4514107..4514436 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| QCG47_RS22065 (4514608) | 4514608..4515666 | - | 1059 | WP_001200891.1 | FUSC family protein | - |
| QCG47_RS22070 (4515864) | 4515864..4516337 | - | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| QCG47_RS22075 (4516456) | 4516456..4517622 | - | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T276782 WP_000854814.1 NZ_CP122319:4512644-4513018 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT276782 WP_001285584.1 NZ_CP122319:4512187-4512555 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |