Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 3945137..3945775 | Replicon | chromosome |
Accession | NZ_CP122319 | ||
Organism | Escherichia coli strain BW25113 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QCG47_RS19140 | Protein ID | WP_000813794.1 |
Coordinates | 3945137..3945313 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QCG47_RS19145 | Protein ID | WP_001270286.1 |
Coordinates | 3945359..3945775 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG47_RS19120 (3940756) | 3940756..3941931 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
QCG47_RS19125 (3942023) | 3942023..3942559 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
QCG47_RS19130 (3942632) | 3942632..3944593 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QCG47_RS19135 (3944685) | 3944685..3944915 | - | 231 | WP_000494244.1 | YncJ family protein | - |
QCG47_RS19140 (3945137) | 3945137..3945313 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QCG47_RS19145 (3945359) | 3945359..3945775 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QCG47_RS19150 (3945854) | 3945854..3947260 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
QCG47_RS19155 (3947505) | 3947505..3948650 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
QCG47_RS19160 (3948668) | 3948668..3949681 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
QCG47_RS19165 (3949682) | 3949682..3950623 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T276775 WP_000813794.1 NZ_CP122319:3945137-3945313 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT276775 WP_001270286.1 NZ_CP122319:3945359-3945775 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|