Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 2700086..2700765 | Replicon | chromosome |
Accession | NZ_CP122319 | ||
Organism | Escherichia coli strain BW25113 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | P77692 |
Locus tag | QCG47_RS12910 | Protein ID | WP_000854672.1 |
Coordinates | 2700086..2700427 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | Q47684 |
Locus tag | QCG47_RS12915 | Protein ID | WP_000070395.1 |
Coordinates | 2700448..2700765 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG47_RS12885 (2695363) | 2695363..2695764 | + | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
QCG47_RS12890 (2695803) | 2695803..2696858 | - | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
QCG47_RS12895 (2697146) | 2697146..2698249 | + | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
QCG47_RS12900 (2698261) | 2698261..2699514 | + | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
QCG47_RS12910 (2700086) | 2700086..2700427 | - | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
QCG47_RS12915 (2700448) | 2700448..2700765 | - | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
QCG47_RS12920 (2700784) | 2700784..2701005 | - | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
QCG47_RS12925 (2701014) | 2701014..2701490 | - | 477 | WP_000811693.1 | RadC family protein | - |
QCG47_RS12930 (2701506) | 2701506..2701964 | - | 459 | WP_000211838.1 | antirestriction protein | - |
QCG47_RS12935 (2702062) | 2702062..2702301 | - | 240 | WP_000194654.1 | DUF905 family protein | - |
QCG47_RS12940 (2702378) | 2702378..2702845 | - | 468 | WP_001547765.1 | protein YkfB | - |
QCG47_RS12945 (2702868) | 2702868..2703311 | - | 444 | WP_000824223.1 | lipoprotein YafY | - |
QCG47_RS12950 (2703311) | 2703311..2703538 | - | 228 | WP_001548158.1 | protein YpjK | - |
QCG47_RS12955 (2703534) | 2703534..2703725 | - | 192 | Protein_2508 | DeoR family transcriptional regulator | - |
QCG47_RS12960 (2703942) | 2703942..2704763 | - | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
QCG47_RS12965 (2704855) | 2704855..2705718 | - | 864 | WP_001065553.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T276764 WP_000854672.1 NZ_CP122319:c2700427-2700086 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|