Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 2247842..2248437 | Replicon | chromosome |
Accession | NZ_CP122319 | ||
Organism | Escherichia coli strain BW25113 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9XNP6 |
Locus tag | QCG47_RS10730 | Protein ID | WP_000239577.1 |
Coordinates | 2248087..2248437 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | QCG47_RS10725 | Protein ID | WP_001223208.1 |
Coordinates | 2247842..2248093 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG47_RS10715 (2243507) | 2243507..2247286 | + | 3780 | WP_000060911.1 | autotransporter assembly complex protein TamB | - |
QCG47_RS10720 (2247289) | 2247289..2247630 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
QCG47_RS10725 (2247842) | 2247842..2248093 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
QCG47_RS10730 (2248087) | 2248087..2248437 | + | 351 | WP_000239577.1 | endoribonuclease toxin ChpB | Toxin |
QCG47_RS10735 (2248517) | 2248517..2249047 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
QCG47_RS10740 (2249357) | 2249357..2250313 | + | 957 | WP_000265913.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
QCG47_RS10745 (2250453) | 2250453..2251955 | + | 1503 | WP_000205805.1 | sugar ABC transporter ATP-binding protein | - |
QCG47_RS10750 (2251969) | 2251969..2252991 | + | 1023 | WP_001313531.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12492.40 Da Isoelectric Point: 5.5572
>T276756 WP_000239577.1 NZ_CP122319:2248087-2248437 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9XNP6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |