Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 580051..580718 | Replicon | chromosome |
Accession | NZ_CP122319 | ||
Organism | Escherichia coli strain BW25113 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | QCG47_RS02735 | Protein ID | WP_001094400.1 |
Coordinates | 580389..580718 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | QCG47_RS02730 | Protein ID | WP_000072690.1 |
Coordinates | 580051..580368 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG47_RS02700 (575103) | 575103..576112 | - | 1010 | Protein_526 | arsenic transporter | - |
QCG47_RS02705 (576254) | 576254..577957 | + | 1704 | WP_000896263.1 | protein YfjW | - |
QCG47_RS02710 (578568) | 578568..578752 | + | 185 | Protein_528 | DUF905 family protein | - |
QCG47_RS02715 (578855) | 578855..579313 | + | 459 | WP_000211841.1 | antirestriction protein | - |
QCG47_RS02720 (579322) | 579322..579804 | + | 483 | WP_001407480.1 | RadC family protein | - |
QCG47_RS02725 (579813) | 579813..580013 | + | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
QCG47_RS02730 (580051) | 580051..580368 | + | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QCG47_RS02735 (580389) | 580389..580718 | + | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
QCG47_RS02740 (581082) | 581082..585662 | - | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T276748 WP_001094400.1 NZ_CP122319:580389-580718 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P52141 |