Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4479020..4479674 | Replicon | chromosome |
Accession | NZ_CP122318 | ||
Organism | Escherichia coli strain HT873X1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | QCG45_RS21960 | Protein ID | WP_000244777.1 |
Coordinates | 4479267..4479674 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QCG45_RS21955 | Protein ID | WP_000354046.1 |
Coordinates | 4479020..4479286 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG45_RS21930 (4474189) | 4474189..4474932 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
QCG45_RS21935 (4474989) | 4474989..4476422 | - | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
QCG45_RS21940 (4476467) | 4476467..4476778 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
QCG45_RS21945 (4476942) | 4476942..4477601 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
QCG45_RS21950 (4477797) | 4477797..4478777 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
QCG45_RS21955 (4479020) | 4479020..4479286 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QCG45_RS21960 (4479267) | 4479267..4479674 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
QCG45_RS21965 (4479714) | 4479714..4480235 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QCG45_RS21970 (4480347) | 4480347..4481243 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QCG45_RS21975 (4481268) | 4481268..4481978 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QCG45_RS21980 (4481984) | 4481984..4483717 | + | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T276746 WP_000244777.1 NZ_CP122318:4479267-4479674 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QD57 |