Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 2810266..2810861 | Replicon | chromosome |
Accession | NZ_CP122318 | ||
Organism | Escherichia coli strain HT873X1 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9XNP6 |
Locus tag | QCG45_RS14015 | Protein ID | WP_000239577.1 |
Coordinates | 2810511..2810861 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | QCG45_RS14010 | Protein ID | WP_001223208.1 |
Coordinates | 2810266..2810517 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG45_RS14000 (2805931) | 2805931..2809710 | + | 3780 | WP_000060911.1 | autotransporter assembly complex protein TamB | - |
QCG45_RS14005 (2809713) | 2809713..2810054 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
QCG45_RS14010 (2810266) | 2810266..2810517 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
QCG45_RS14015 (2810511) | 2810511..2810861 | + | 351 | WP_000239577.1 | endoribonuclease toxin ChpB | Toxin |
QCG45_RS14020 (2810941) | 2810941..2811471 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
QCG45_RS14025 (2811781) | 2811781..2812737 | + | 957 | WP_000265913.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
QCG45_RS14030 (2812877) | 2812877..2814379 | + | 1503 | WP_000205805.1 | sugar ABC transporter ATP-binding protein | - |
QCG45_RS14035 (2814393) | 2814393..2815415 | + | 1023 | WP_001313531.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12492.40 Da Isoelectric Point: 5.5572
>T276736 WP_000239577.1 NZ_CP122318:2810511-2810861 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9XNP6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |