Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 2265287..2265966 Replicon chromosome
Accession NZ_CP122318
Organism Escherichia coli strain HT873X1

Toxin (Protein)


Gene name ykfI Uniprot ID P77692
Locus tag QCG45_RS11220 Protein ID WP_000854672.1
Coordinates 2265287..2265628 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID Q47684
Locus tag QCG45_RS11225 Protein ID WP_000070395.1
Coordinates 2265649..2265966 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QCG45_RS11195 (2260564) 2260564..2260965 + 402 WP_000174689.1 sigma factor-binding protein Crl -
QCG45_RS11200 (2261004) 2261004..2262059 - 1056 WP_000749863.1 phosphoporin PhoE -
QCG45_RS11205 (2262347) 2262347..2263450 + 1104 WP_001285288.1 glutamate 5-kinase -
QCG45_RS11210 (2263462) 2263462..2264715 + 1254 WP_000893278.1 glutamate-5-semialdehyde dehydrogenase -
QCG45_RS11220 (2265287) 2265287..2265628 - 342 WP_000854672.1 type IV toxin-antitoxin system toxin YkfI Toxin
QCG45_RS11225 (2265649) 2265649..2265966 - 318 WP_000070395.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
QCG45_RS11230 (2265985) 2265985..2266206 - 222 WP_000691994.1 DUF987 domain-containing protein -
QCG45_RS11235 (2266215) 2266215..2266691 - 477 WP_000811693.1 RadC family protein -
QCG45_RS11240 (2266707) 2266707..2267165 - 459 WP_000211838.1 antirestriction protein -
QCG45_RS11245 (2267263) 2267263..2267502 - 240 WP_000194654.1 DUF905 family protein -
QCG45_RS11250 (2267579) 2267579..2268046 - 468 WP_001547765.1 protein YkfB -
QCG45_RS11255 (2268069) 2268069..2268512 - 444 WP_000824223.1 lipoprotein YafY -
QCG45_RS11260 (2268512) 2268512..2268739 - 228 WP_001548158.1 protein YpjK -
QCG45_RS11265 (2268735) 2268735..2268926 - 192 Protein_2194 DeoR family transcriptional regulator -
QCG45_RS11270 (2269143) 2269143..2269964 - 822 WP_000197389.1 DUF932 domain-containing protein -
QCG45_RS11275 (2270056) 2270056..2270919 - 864 WP_001065553.1 GTPase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12905.01 Da        Isoelectric Point: 9.6543

>T276734 WP_000854672.1 NZ_CP122318:c2265628-2265287 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11939.59 Da        Isoelectric Point: 6.7391

>AT276734 WP_000070395.1 NZ_CP122318:c2265966-2265649 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P77692

Antitoxin

Source ID Structure
AlphaFold DB Q47684

References