Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 2265287..2265966 | Replicon | chromosome |
Accession | NZ_CP122318 | ||
Organism | Escherichia coli strain HT873X1 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | P77692 |
Locus tag | QCG45_RS11220 | Protein ID | WP_000854672.1 |
Coordinates | 2265287..2265628 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | Q47684 |
Locus tag | QCG45_RS11225 | Protein ID | WP_000070395.1 |
Coordinates | 2265649..2265966 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG45_RS11195 (2260564) | 2260564..2260965 | + | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
QCG45_RS11200 (2261004) | 2261004..2262059 | - | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
QCG45_RS11205 (2262347) | 2262347..2263450 | + | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
QCG45_RS11210 (2263462) | 2263462..2264715 | + | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
QCG45_RS11220 (2265287) | 2265287..2265628 | - | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
QCG45_RS11225 (2265649) | 2265649..2265966 | - | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
QCG45_RS11230 (2265985) | 2265985..2266206 | - | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
QCG45_RS11235 (2266215) | 2266215..2266691 | - | 477 | WP_000811693.1 | RadC family protein | - |
QCG45_RS11240 (2266707) | 2266707..2267165 | - | 459 | WP_000211838.1 | antirestriction protein | - |
QCG45_RS11245 (2267263) | 2267263..2267502 | - | 240 | WP_000194654.1 | DUF905 family protein | - |
QCG45_RS11250 (2267579) | 2267579..2268046 | - | 468 | WP_001547765.1 | protein YkfB | - |
QCG45_RS11255 (2268069) | 2268069..2268512 | - | 444 | WP_000824223.1 | lipoprotein YafY | - |
QCG45_RS11260 (2268512) | 2268512..2268739 | - | 228 | WP_001548158.1 | protein YpjK | - |
QCG45_RS11265 (2268735) | 2268735..2268926 | - | 192 | Protein_2194 | DeoR family transcriptional regulator | - |
QCG45_RS11270 (2269143) | 2269143..2269964 | - | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
QCG45_RS11275 (2270056) | 2270056..2270919 | - | 864 | WP_001065553.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T276734 WP_000854672.1 NZ_CP122318:c2265628-2265287 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|