Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 1404791..1405429 | Replicon | chromosome |
Accession | NZ_CP122318 | ||
Organism | Escherichia coli strain HT873X1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QCG45_RS06875 | Protein ID | WP_000813794.1 |
Coordinates | 1405253..1405429 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QCG45_RS06870 | Protein ID | WP_001270286.1 |
Coordinates | 1404791..1405207 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG45_RS06850 (1399943) | 1399943..1400884 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
QCG45_RS06855 (1400885) | 1400885..1401898 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
QCG45_RS06860 (1401916) | 1401916..1403061 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
QCG45_RS06865 (1403306) | 1403306..1404712 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
QCG45_RS06870 (1404791) | 1404791..1405207 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QCG45_RS06875 (1405253) | 1405253..1405429 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QCG45_RS06880 (1405651) | 1405651..1405881 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QCG45_RS06885 (1405973) | 1405973..1407934 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QCG45_RS06890 (1408007) | 1408007..1408543 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
QCG45_RS06895 (1408635) | 1408635..1409810 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T276731 WP_000813794.1 NZ_CP122318:c1405429-1405253 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT276731 WP_001270286.1 NZ_CP122318:c1405207-1404791 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|