Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 837547..838378 | Replicon | chromosome |
| Accession | NZ_CP122318 | ||
| Organism | Escherichia coli strain HT873X1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | QCG45_RS03980 | Protein ID | WP_000854814.1 |
| Coordinates | 837547..837921 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | QCG45_RS03985 | Protein ID | WP_001285584.1 |
| Coordinates | 838010..838378 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCG45_RS03940 (832943) | 832943..834109 | + | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| QCG45_RS03945 (834228) | 834228..834701 | + | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| QCG45_RS03950 (834899) | 834899..835957 | + | 1059 | WP_001200891.1 | FUSC family protein | - |
| QCG45_RS03955 (836129) | 836129..836458 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| QCG45_RS03960 (836559) | 836559..836693 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| QCG45_RS03965 (836813) | 836813..836941 | + | 129 | Protein_773 | transposase domain-containing protein | - |
| QCG45_RS03970 (837230) | 837230..837310 | - | 81 | Protein_774 | hypothetical protein | - |
| QCG45_RS03975 (837356) | 837356..837550 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| QCG45_RS03980 (837547) | 837547..837921 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QCG45_RS03985 (838010) | 838010..838378 | - | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QCG45_RS03990 (838452) | 838452..838673 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QCG45_RS03995 (838736) | 838736..839182 | - | 447 | WP_000187523.1 | RadC family protein | - |
| QCG45_RS04000 (839179) | 839179..840711 | - | 1533 | WP_001350525.1 | protein YeeR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T276724 WP_000854814.1 NZ_CP122318:c837921-837547 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT276724 WP_001285584.1 NZ_CP122318:c838378-838010 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |