Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 3786045..3786724 Replicon chromosome
Accession NZ_CP122317
Organism Escherichia coli strain HT-948

Toxin (Protein)


Gene name ykfI Uniprot ID P77692
Locus tag QCG49_RS18350 Protein ID WP_000854672.1
Coordinates 3786383..3786724 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID Q47684
Locus tag QCG49_RS18345 Protein ID WP_000070395.1
Coordinates 3786045..3786362 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QCG49_RS18295 (3781092) 3781092..3781955 + 864 WP_001065553.1 GTPase family protein -
QCG49_RS18300 (3782047) 3782047..3782868 + 822 WP_000197389.1 DUF932 domain-containing protein -
QCG49_RS18305 (3783085) 3783085..3783276 + 192 Protein_3566 DeoR family transcriptional regulator -
QCG49_RS18310 (3783272) 3783272..3783499 + 228 WP_001548158.1 protein YpjK -
QCG49_RS18315 (3783499) 3783499..3783942 + 444 WP_000824223.1 lipoprotein YafY -
QCG49_RS18320 (3783965) 3783965..3784432 + 468 WP_001547765.1 protein YkfB -
QCG49_RS18325 (3784509) 3784509..3784748 + 240 WP_000194654.1 DUF905 family protein -
QCG49_RS18330 (3784846) 3784846..3785304 + 459 WP_000211838.1 antirestriction protein -
QCG49_RS18335 (3785320) 3785320..3785796 + 477 WP_000811693.1 RadC family protein -
QCG49_RS18340 (3785805) 3785805..3786026 + 222 WP_000691994.1 DUF987 domain-containing protein -
QCG49_RS18345 (3786045) 3786045..3786362 + 318 WP_000070395.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
QCG49_RS18350 (3786383) 3786383..3786724 + 342 WP_000854672.1 type IV toxin-antitoxin system toxin YkfI Toxin
QCG49_RS18360 (3787296) 3787296..3788549 - 1254 WP_000893278.1 glutamate-5-semialdehyde dehydrogenase -
QCG49_RS18365 (3788561) 3788561..3789664 - 1104 WP_001285288.1 glutamate 5-kinase -
QCG49_RS18370 (3789952) 3789952..3791007 + 1056 WP_000749863.1 phosphoporin PhoE -
QCG49_RS18375 (3791046) 3791046..3791447 - 402 WP_000174689.1 sigma factor-binding protein Crl -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12905.01 Da        Isoelectric Point: 9.6543

>T276708 WP_000854672.1 NZ_CP122317:3786383-3786724 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11939.59 Da        Isoelectric Point: 6.7391

>AT276708 WP_000070395.1 NZ_CP122317:3786045-3786362 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P77692

Antitoxin

Source ID Structure
AlphaFold DB Q47684

References