Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3567925..3568543 | Replicon | chromosome |
Accession | NZ_CP122317 | ||
Organism | Escherichia coli strain HT-948 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QCG49_RS17225 | Protein ID | WP_001291435.1 |
Coordinates | 3568325..3568543 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QCG49_RS17220 | Protein ID | WP_000344800.1 |
Coordinates | 3567925..3568299 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG49_RS17210 (3563014) | 3563014..3564207 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QCG49_RS17215 (3564230) | 3564230..3567379 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QCG49_RS17220 (3567925) | 3567925..3568299 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QCG49_RS17225 (3568325) | 3568325..3568543 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QCG49_RS17230 (3568715) | 3568715..3569266 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QCG49_RS17235 (3569382) | 3569382..3569852 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QCG49_RS17240 (3570016) | 3570016..3571566 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QCG49_RS17245 (3571608) | 3571608..3571961 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QCG49_RS17255 (3572340) | 3572340..3572651 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QCG49_RS17260 (3572682) | 3572682..3573254 | - | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T276707 WP_001291435.1 NZ_CP122317:3568325-3568543 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT276707 WP_000344800.1 NZ_CP122317:3567925-3568299 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |