Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 607847..608678 | Replicon | chromosome |
Accession | NZ_CP122317 | ||
Organism | Escherichia coli strain HT-948 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1P968 |
Locus tag | QCG49_RS03080 | Protein ID | WP_000854814.1 |
Coordinates | 608304..608678 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | P76364 |
Locus tag | QCG49_RS03075 | Protein ID | WP_001285584.1 |
Coordinates | 607847..608215 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG49_RS03060 (605514) | 605514..607046 | + | 1533 | WP_001350525.1 | protein YeeR | - |
QCG49_RS03065 (607043) | 607043..607489 | + | 447 | WP_000187523.1 | RadC family protein | - |
QCG49_RS03070 (607552) | 607552..607773 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
QCG49_RS03075 (607847) | 607847..608215 | + | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
QCG49_RS03080 (608304) | 608304..608678 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
QCG49_RS03085 (608675) | 608675..608869 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
QCG49_RS03090 (608915) | 608915..608995 | + | 81 | Protein_606 | hypothetical protein | - |
QCG49_RS03095 (609284) | 609284..609412 | - | 129 | Protein_607 | transposase domain-containing protein | - |
QCG49_RS03100 (609532) | 609532..609666 | + | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
QCG49_RS03105 (609767) | 609767..610096 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
QCG49_RS03110 (610268) | 610268..611326 | - | 1059 | WP_001200891.1 | FUSC family protein | - |
QCG49_RS03115 (611524) | 611524..611997 | - | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
QCG49_RS03120 (612116) | 612116..613282 | - | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T276693 WP_000854814.1 NZ_CP122317:608304-608678 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FY50 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2H28 | |
AlphaFold DB | A0A1M2E8G6 |