Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 2231871..2232550 Replicon chromosome
Accession NZ_CP122316
Organism Escherichia coli strain HT-946

Toxin (Protein)


Gene name ykfI Uniprot ID P77692
Locus tag QCG48_RS11090 Protein ID WP_000854672.1
Coordinates 2231871..2232212 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID Q47684
Locus tag QCG48_RS11095 Protein ID WP_000070395.1
Coordinates 2232233..2232550 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QCG48_RS11065 (2227148) 2227148..2227549 + 402 WP_000174689.1 sigma factor-binding protein Crl -
QCG48_RS11070 (2227588) 2227588..2228643 - 1056 WP_000749863.1 phosphoporin PhoE -
QCG48_RS11075 (2228931) 2228931..2230034 + 1104 WP_001285288.1 glutamate 5-kinase -
QCG48_RS11080 (2230046) 2230046..2231299 + 1254 WP_000893278.1 glutamate-5-semialdehyde dehydrogenase -
QCG48_RS11090 (2231871) 2231871..2232212 - 342 WP_000854672.1 type IV toxin-antitoxin system toxin YkfI Toxin
QCG48_RS11095 (2232233) 2232233..2232550 - 318 WP_000070395.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
QCG48_RS11100 (2232569) 2232569..2232790 - 222 WP_000691994.1 DUF987 domain-containing protein -
QCG48_RS11105 (2232799) 2232799..2233275 - 477 WP_000811693.1 RadC family protein -
QCG48_RS11110 (2233291) 2233291..2233749 - 459 WP_000211838.1 antirestriction protein -
QCG48_RS11115 (2233847) 2233847..2234086 - 240 WP_000194654.1 DUF905 family protein -
QCG48_RS11120 (2234163) 2234163..2234630 - 468 WP_001547765.1 protein YkfB -
QCG48_RS11125 (2234653) 2234653..2235096 - 444 WP_000824223.1 lipoprotein YafY -
QCG48_RS11130 (2235096) 2235096..2235323 - 228 WP_001548158.1 protein YpjK -
QCG48_RS11135 (2235319) 2235319..2235510 - 192 Protein_2168 DeoR family transcriptional regulator -
QCG48_RS11140 (2235727) 2235727..2236548 - 822 WP_000197389.1 DUF932 domain-containing protein -
QCG48_RS11145 (2236640) 2236640..2237503 - 864 WP_001065553.1 GTPase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12905.01 Da        Isoelectric Point: 9.6543

>T276672 WP_000854672.1 NZ_CP122316:c2232212-2231871 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11939.59 Da        Isoelectric Point: 6.7391

>AT276672 WP_000070395.1 NZ_CP122316:c2232550-2232233 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P77692

Antitoxin

Source ID Structure
AlphaFold DB Q47684

References