Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 2231871..2232550 | Replicon | chromosome |
| Accession | NZ_CP122316 | ||
| Organism | Escherichia coli strain HT-946 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | P77692 |
| Locus tag | QCG48_RS11090 | Protein ID | WP_000854672.1 |
| Coordinates | 2231871..2232212 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | Q47684 |
| Locus tag | QCG48_RS11095 | Protein ID | WP_000070395.1 |
| Coordinates | 2232233..2232550 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCG48_RS11065 (2227148) | 2227148..2227549 | + | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
| QCG48_RS11070 (2227588) | 2227588..2228643 | - | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
| QCG48_RS11075 (2228931) | 2228931..2230034 | + | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
| QCG48_RS11080 (2230046) | 2230046..2231299 | + | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
| QCG48_RS11090 (2231871) | 2231871..2232212 | - | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| QCG48_RS11095 (2232233) | 2232233..2232550 | - | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| QCG48_RS11100 (2232569) | 2232569..2232790 | - | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| QCG48_RS11105 (2232799) | 2232799..2233275 | - | 477 | WP_000811693.1 | RadC family protein | - |
| QCG48_RS11110 (2233291) | 2233291..2233749 | - | 459 | WP_000211838.1 | antirestriction protein | - |
| QCG48_RS11115 (2233847) | 2233847..2234086 | - | 240 | WP_000194654.1 | DUF905 family protein | - |
| QCG48_RS11120 (2234163) | 2234163..2234630 | - | 468 | WP_001547765.1 | protein YkfB | - |
| QCG48_RS11125 (2234653) | 2234653..2235096 | - | 444 | WP_000824223.1 | lipoprotein YafY | - |
| QCG48_RS11130 (2235096) | 2235096..2235323 | - | 228 | WP_001548158.1 | protein YpjK | - |
| QCG48_RS11135 (2235319) | 2235319..2235510 | - | 192 | Protein_2168 | DeoR family transcriptional regulator | - |
| QCG48_RS11140 (2235727) | 2235727..2236548 | - | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
| QCG48_RS11145 (2236640) | 2236640..2237503 | - | 864 | WP_001065553.1 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T276672 WP_000854672.1 NZ_CP122316:c2232212-2231871 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|