Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 1371376..1372014 | Replicon | chromosome |
| Accession | NZ_CP122316 | ||
| Organism | Escherichia coli strain HT-946 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | QCG48_RS06745 | Protein ID | WP_000813794.1 |
| Coordinates | 1371838..1372014 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QCG48_RS06740 | Protein ID | WP_001270286.1 |
| Coordinates | 1371376..1371792 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCG48_RS06720 (1366528) | 1366528..1367469 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
| QCG48_RS06725 (1367470) | 1367470..1368483 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| QCG48_RS06730 (1368501) | 1368501..1369646 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| QCG48_RS06735 (1369891) | 1369891..1371297 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| QCG48_RS06740 (1371376) | 1371376..1371792 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| QCG48_RS06745 (1371838) | 1371838..1372014 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| QCG48_RS06750 (1372236) | 1372236..1372466 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| QCG48_RS06755 (1372558) | 1372558..1374519 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| QCG48_RS06760 (1374592) | 1374592..1375128 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| QCG48_RS06765 (1375220) | 1375220..1376395 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T276669 WP_000813794.1 NZ_CP122316:c1372014-1371838 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT276669 WP_001270286.1 NZ_CP122316:c1371792-1371376 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|