Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4450967..4451621 | Replicon | chromosome |
| Accession | NZ_CP122315 | ||
| Organism | Escherichia coli strain HT-947 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | QCG46_RS21775 | Protein ID | WP_000244777.1 |
| Coordinates | 4450967..4451374 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | QCG46_RS21780 | Protein ID | WP_000354046.1 |
| Coordinates | 4451355..4451621 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCG46_RS21755 (4446924) | 4446924..4448657 | - | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| QCG46_RS21760 (4448663) | 4448663..4449373 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QCG46_RS21765 (4449398) | 4449398..4450294 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| QCG46_RS21770 (4450406) | 4450406..4450927 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| QCG46_RS21775 (4450967) | 4450967..4451374 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
| QCG46_RS21780 (4451355) | 4451355..4451621 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| QCG46_RS21785 (4451864) | 4451864..4452844 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| QCG46_RS21790 (4453040) | 4453040..4453699 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| QCG46_RS21795 (4453863) | 4453863..4454174 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| QCG46_RS21800 (4454219) | 4454219..4455652 | + | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
| QCG46_RS21805 (4455709) | 4455709..4456452 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T276657 WP_000244777.1 NZ_CP122315:c4451374-4450967 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |