Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 4187666..4188333 | Replicon | chromosome |
| Accession | NZ_CP122315 | ||
| Organism | Escherichia coli strain HT-947 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | Q46953 |
| Locus tag | QCG46_RS20550 | Protein ID | WP_001094400.1 |
| Coordinates | 4188004..4188333 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | P52141 |
| Locus tag | QCG46_RS20545 | Protein ID | WP_000072690.1 |
| Coordinates | 4187666..4187983 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCG46_RS20515 (4182718) | 4182718..4183727 | - | 1010 | Protein_3993 | arsenic transporter | - |
| QCG46_RS20520 (4183869) | 4183869..4185572 | + | 1704 | WP_000896263.1 | protein YfjW | - |
| QCG46_RS20525 (4186183) | 4186183..4186367 | + | 185 | Protein_3995 | DUF905 family protein | - |
| QCG46_RS20530 (4186470) | 4186470..4186928 | + | 459 | WP_000211841.1 | antirestriction protein | - |
| QCG46_RS20535 (4186937) | 4186937..4187419 | + | 483 | WP_001407480.1 | RadC family protein | - |
| QCG46_RS20540 (4187428) | 4187428..4187628 | + | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
| QCG46_RS20545 (4187666) | 4187666..4187983 | + | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QCG46_RS20550 (4188004) | 4188004..4188333 | + | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
| QCG46_RS20555 (4188697) | 4188697..4193277 | - | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T276655 WP_001094400.1 NZ_CP122315:4188004-4188333 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A373F4I3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2EA9 | |
| PDB | 2JN7 | |
| AlphaFold DB | P52141 |