Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2920736..2921374 | Replicon | chromosome |
Accession | NZ_CP122315 | ||
Organism | Escherichia coli strain HT-947 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QCG46_RS14340 | Protein ID | WP_000813794.1 |
Coordinates | 2920736..2920912 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QCG46_RS14345 | Protein ID | WP_001270286.1 |
Coordinates | 2920958..2921374 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG46_RS14320 (2916355) | 2916355..2917530 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
QCG46_RS14325 (2917622) | 2917622..2918158 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
QCG46_RS14330 (2918231) | 2918231..2920192 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QCG46_RS14335 (2920284) | 2920284..2920514 | - | 231 | WP_000494244.1 | YncJ family protein | - |
QCG46_RS14340 (2920736) | 2920736..2920912 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QCG46_RS14345 (2920958) | 2920958..2921374 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QCG46_RS14350 (2921453) | 2921453..2922859 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
QCG46_RS14355 (2923104) | 2923104..2924249 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
QCG46_RS14360 (2924267) | 2924267..2925280 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
QCG46_RS14365 (2925281) | 2925281..2926222 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T276645 WP_000813794.1 NZ_CP122315:2920736-2920912 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT276645 WP_001270286.1 NZ_CP122315:2920958-2921374 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|