Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 2060199..2060878 | Replicon | chromosome |
Accession | NZ_CP122315 | ||
Organism | Escherichia coli strain HT-947 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | P77692 |
Locus tag | QCG46_RS09990 | Protein ID | WP_000854672.1 |
Coordinates | 2060537..2060878 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | Q47684 |
Locus tag | QCG46_RS09985 | Protein ID | WP_000070395.1 |
Coordinates | 2060199..2060516 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG46_RS09935 (2055246) | 2055246..2056109 | + | 864 | WP_001065553.1 | GTPase family protein | - |
QCG46_RS09940 (2056201) | 2056201..2057022 | + | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
QCG46_RS09945 (2057239) | 2057239..2057430 | + | 192 | Protein_1931 | DeoR family transcriptional regulator | - |
QCG46_RS09950 (2057426) | 2057426..2057653 | + | 228 | WP_001548158.1 | protein YpjK | - |
QCG46_RS09955 (2057653) | 2057653..2058096 | + | 444 | WP_000824223.1 | lipoprotein YafY | - |
QCG46_RS09960 (2058119) | 2058119..2058586 | + | 468 | WP_001547765.1 | protein YkfB | - |
QCG46_RS09965 (2058663) | 2058663..2058902 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
QCG46_RS09970 (2059000) | 2059000..2059458 | + | 459 | WP_000211838.1 | antirestriction protein | - |
QCG46_RS09975 (2059474) | 2059474..2059950 | + | 477 | WP_000811693.1 | RadC family protein | - |
QCG46_RS09980 (2059959) | 2059959..2060180 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
QCG46_RS09985 (2060199) | 2060199..2060516 | + | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
QCG46_RS09990 (2060537) | 2060537..2060878 | + | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
QCG46_RS10000 (2061450) | 2061450..2062703 | - | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
QCG46_RS10005 (2062715) | 2062715..2063818 | - | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
QCG46_RS10010 (2064106) | 2064106..2065161 | + | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
QCG46_RS10015 (2065200) | 2065200..2065601 | - | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T276633 WP_000854672.1 NZ_CP122315:2060537-2060878 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|