Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 1428983..1429797 | Replicon | chromosome |
Accession | NZ_CP122315 | ||
Organism | Escherichia coli strain HT-947 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | QCG46_RS06770 | Protein ID | WP_001054376.1 |
Coordinates | 1428983..1429240 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | QCG46_RS06775 | Protein ID | WP_001309181.1 |
Coordinates | 1429252..1429797 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG46_RS06745 (1424271) | 1424271..1425377 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
QCG46_RS06750 (1425442) | 1425442..1426422 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
QCG46_RS06755 (1426532) | 1426532..1426737 | + | 206 | Protein_1307 | HNH endonuclease | - |
QCG46_RS06760 (1427005) | 1427005..1428245 | - | 1241 | Protein_1308 | helicase YjhR | - |
QCG46_RS06765 (1428361) | 1428361..1428492 | + | 132 | WP_001309182.1 | hypothetical protein | - |
QCG46_RS06770 (1428983) | 1428983..1429240 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
QCG46_RS06775 (1429252) | 1429252..1429797 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
QCG46_RS06780 (1429853) | 1429853..1430599 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
QCG46_RS06785 (1430768) | 1430768..1430986 | + | 219 | Protein_1313 | hypothetical protein | - |
QCG46_RS06790 (1431024) | 1431024..1431140 | + | 117 | Protein_1314 | VOC family protein | - |
QCG46_RS06795 (1431385) | 1431385..1432506 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
QCG46_RS06800 (1432503) | 1432503..1432781 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
QCG46_RS06805 (1432793) | 1432793..1434106 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimI / fimA / fimE / fimB | 1418769..1438021 | 19252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T276630 WP_001054376.1 NZ_CP122315:1428983-1429240 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT276630 WP_001309181.1 NZ_CP122315:1429252-1429797 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|