276622

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 24906..25431 Replicon plasmid unnamed1
Accession NZ_CP122302
Organism Salmonella enterica strain 27A

Toxin (Protein)


Gene name ccdB Uniprot ID I3W3D5
Locus tag P8R57_RS22920 Protein ID WP_001159863.1
Coordinates 25126..25431 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag P8R57_RS22915 Protein ID WP_000813641.1
Coordinates 24906..25124 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8R57_RS22885 20520..20906 + 387 WP_000751876.1 YgiW/YdeI family stress tolerance OB fold protein -
P8R57_RS22890 20959..21078 + 120 Protein_30 recombinase -
P8R57_RS22895 21447..22436 - 990 WP_000461382.1 RepB family plasmid replication initiator protein -
P8R57_RS22900 22930..23225 - 296 Protein_32 cytoplasmic protein -
P8R57_RS22905 23237..23665 + 429 Protein_33 hypothetical protein -
P8R57_RS22910 23709..24230 - 522 WP_077681952.1 hypothetical protein -
P8R57_RS22915 24906..25124 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
P8R57_RS22920 25126..25431 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB Toxin
P8R57_RS22925 25433..25723 + 291 WP_001266176.1 hypothetical protein -
P8R57_RS22930 25720..26241 + 522 WP_000198608.1 hypothetical protein -
P8R57_RS22935 26276..27058 + 783 WP_000082169.1 site-specific integrase -
P8R57_RS22940 27067..27780 + 714 WP_000545756.1 EAL domain-containing protein -
P8R57_RS22945 27805..28293 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
P8R57_RS22950 28287..28772 + 486 WP_000905606.1 membrane protein -
P8R57_RS22955 29049..29336 - 288 WP_071530243.1 hypothetical protein -
P8R57_RS22960 29492..30052 + 561 WP_000900095.1 inverse autotransporter beta domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1B rck / pefD / pefC / pefA / pefB / fdeC / spvC / spvB 1..64327 64327


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11587.48 Da        Isoelectric Point: 6.9787

>T276622 WP_001159863.1 NZ_CP122302:25126-25431 [Salmonella enterica]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT276622 WP_000813641.1 NZ_CP122302:24906-25124 [Salmonella enterica]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I3W3D5

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References