Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4179234..4180015 | Replicon | chromosome |
Accession | NZ_CP122301 | ||
Organism | Salmonella enterica strain 27A |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | B5R980 |
Locus tag | P8R57_RS20450 | Protein ID | WP_000626100.1 |
Coordinates | 4179234..4179725 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | P8R57_RS20455 | Protein ID | WP_001110452.1 |
Coordinates | 4179722..4180015 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8R57_RS20415 (4174694) | 4174694..4175041 | + | 348 | WP_000887832.1 | divalent cation tolerance protein CutA | - |
P8R57_RS20420 (4175017) | 4175017..4176720 | + | 1704 | WP_000068885.1 | protein-disulfide reductase DsbD | - |
P8R57_RS20425 (4176757) | 4176757..4177332 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
P8R57_RS20435 (4177603) | 4177603..4177677 | - | 75 | Protein_3993 | helix-turn-helix domain-containing protein | - |
P8R57_RS20440 (4178057) | 4178057..4178134 | + | 78 | Protein_3994 | porin family protein | - |
P8R57_RS20445 (4178234) | 4178234..4178986 | + | 753 | WP_000842433.1 | non-specific acid phosphatase | - |
P8R57_RS20450 (4179234) | 4179234..4179725 | - | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
P8R57_RS20455 (4179722) | 4179722..4180015 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
P8R57_RS20460 (4180332) | 4180332..4180553 | + | 222 | WP_001576552.1 | hypothetical protein | - |
P8R57_RS20465 (4180819) | 4180819..4181694 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
P8R57_RS20470 (4181691) | 4181691..4181978 | + | 288 | WP_001541332.1 | transcriptional regulator RtsB | - |
P8R57_RS20475 (4181971) | 4181971..4182279 | - | 309 | WP_072095651.1 | ABC transporter ATP-binding protein | - |
P8R57_RS20480 (4182278) | 4182278..4182526 | + | 249 | Protein_4002 | Ig-like domain-containing protein | - |
P8R57_RS20485 (4182638) | 4182638..4182769 | + | 132 | Protein_4003 | hypothetical protein | - |
P8R57_RS20490 (4183063) | 4183063..4183968 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T276619 WP_000626100.1 NZ_CP122301:c4179725-4179234 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656IQ80 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |