Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4031213..4031763 | Replicon | chromosome |
Accession | NZ_CP122301 | ||
Organism | Salmonella enterica strain 27A |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | P8R57_RS19670 | Protein ID | WP_001199743.1 |
Coordinates | 4031213..4031521 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | M7RP97 |
Locus tag | P8R57_RS19675 | Protein ID | WP_001118105.1 |
Coordinates | 4031524..4031763 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8R57_RS19650 (4027787) | 4027787..4028527 | - | 741 | WP_001676217.1 | SEF14/SEF18 fimbria chaperone SefB | - |
P8R57_RS19655 (4028649) | 4028649..4029179 | - | 531 | WP_000909461.1 | SEF14 fimbria major subunit SefA | - |
P8R57_RS19660 (4029502) | 4029502..4030635 | + | 1134 | Protein_3843 | IS3 family transposase | - |
P8R57_RS19665 (4030667) | 4030667..4030807 | - | 141 | Protein_3844 | Arm DNA-binding domain-containing protein | - |
P8R57_RS19670 (4031213) | 4031213..4031521 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
P8R57_RS19675 (4031524) | 4031524..4031763 | - | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
P8R57_RS19680 (4031872) | 4031872..4032120 | - | 249 | WP_000168388.1 | ribbon-helix-helix domain-containing protein | - |
P8R57_RS19685 (4032197) | 4032197..4032742 | - | 546 | WP_223151225.1 | helix-turn-helix domain-containing protein | - |
P8R57_RS19695 (4033499) | 4033499..4034518 | + | 1020 | WP_000152558.1 | NAD(P)-dependent alcohol dehydrogenase | - |
P8R57_RS19700 (4034546) | 4034546..4035076 | - | 531 | WP_000896758.1 | gluconokinase | - |
P8R57_RS19705 (4035293) | 4035293..4036324 | + | 1032 | WP_000453347.1 | L-idonate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 4029594..4032697 | 3103 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T276617 WP_001199743.1 NZ_CP122301:c4031521-4031213 [Salmonella enterica]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H9SZK8 |