Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 3986953..3987529 | Replicon | chromosome |
Accession | NZ_CP122301 | ||
Organism | Salmonella enterica strain 27A |
Toxin (Protein)
Gene name | shpA | Uniprot ID | M7RG88 |
Locus tag | P8R57_RS19455 | Protein ID | WP_001131963.1 |
Coordinates | 3987242..3987529 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | B5R9R5 |
Locus tag | P8R57_RS19450 | Protein ID | WP_000063142.1 |
Coordinates | 3986953..3987255 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8R57_RS19435 (3983463) | 3983463..3985613 | + | 2151 | WP_000379928.1 | pyruvate/proton symporter BtsT | - |
P8R57_RS19440 (3985708) | 3985708..3985911 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
P8R57_RS19445 (3985922) | 3985922..3986878 | + | 957 | WP_000187843.1 | GTPase | - |
P8R57_RS19450 (3986953) | 3986953..3987255 | - | 303 | WP_000063142.1 | BrnA antitoxin family protein | Antitoxin |
P8R57_RS19455 (3987242) | 3987242..3987529 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
P8R57_RS19460 (3987946) | 3987946..3989202 | + | 1257 | Protein_3803 | NERD domain-containing protein/DEAD/DEAH box helicase | - |
P8R57_RS19465 (3989196) | 3989196..3989375 | + | 180 | Protein_3804 | DNA methyltransferase | - |
P8R57_RS19470 (3989365) | 3989365..3990669 | + | 1305 | WP_000863534.1 | type I restriction-modification protein specificity subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T276616 WP_001131963.1 NZ_CP122301:c3987529-3987242 [Salmonella enterica]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7VD7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7VD7 | |
AlphaFold DB | A0A4D6PB01 |