Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3411432..3412052 | Replicon | chromosome |
Accession | NZ_CP122301 | ||
Organism | Salmonella enterica strain 27A |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | P8R57_RS16805 | Protein ID | WP_001280991.1 |
Coordinates | 3411834..3412052 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | P8R57_RS16800 | Protein ID | WP_000344807.1 |
Coordinates | 3411432..3411806 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8R57_RS16790 (3406571) | 3406571..3407764 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P8R57_RS16795 (3407787) | 3407787..3410936 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
P8R57_RS16800 (3411432) | 3411432..3411806 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
P8R57_RS16805 (3411834) | 3411834..3412052 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
P8R57_RS16810 (3412231) | 3412231..3412782 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
P8R57_RS16815 (3412900) | 3412900..3413370 | + | 471 | WP_000136183.1 | YlaC family protein | - |
P8R57_RS16820 (3413426) | 3413426..3413566 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
P8R57_RS16825 (3413572) | 3413572..3413832 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
P8R57_RS16830 (3414057) | 3414057..3415607 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
P8R57_RS16840 (3415838) | 3415838..3416227 | + | 390 | WP_000961287.1 | MGMT family protein | - |
P8R57_RS16845 (3416260) | 3416260..3416829 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T276613 WP_001280991.1 NZ_CP122301:3411834-3412052 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT276613 WP_000344807.1 NZ_CP122301:3411432-3411806 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|