Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3843691..3844327 | Replicon | chromosome |
Accession | NZ_CP121861 | ||
Organism | Bacillus stercoris strain Mal05 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QA442_RS19940 | Protein ID | WP_003156187.1 |
Coordinates | 3843691..3844041 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | QA442_RS19945 | Protein ID | WP_003225183.1 |
Coordinates | 3844046..3844327 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA442_RS19900 (3838735) | 3838735..3839334 | - | 600 | WP_040084112.1 | phosphoserine phosphatase RsbX | - |
QA442_RS19905 (3839334) | 3839334..3840122 | - | 789 | WP_014662857.1 | RNA polymerase sigma factor SigB | - |
QA442_RS19910 (3840088) | 3840088..3840570 | - | 483 | WP_014662856.1 | anti-sigma B factor RsbW | - |
QA442_RS19915 (3840567) | 3840567..3840896 | - | 330 | WP_095432086.1 | anti-sigma factor antagonist RsbV | - |
QA442_RS19920 (3840958) | 3840958..3841965 | - | 1008 | WP_095432087.1 | phosphoserine phosphatase RsbU | - |
QA442_RS19925 (3841977) | 3841977..3842378 | - | 402 | WP_003240352.1 | serine/threonine-protein kinase RsbT | - |
QA442_RS19930 (3842382) | 3842382..3842747 | - | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
QA442_RS19935 (3842752) | 3842752..3843576 | - | 825 | WP_095432088.1 | RsbT co-antagonist protein RsbRA | - |
QA442_RS19940 (3843691) | 3843691..3844041 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QA442_RS19945 (3844046) | 3844046..3844327 | - | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QA442_RS19950 (3844443) | 3844443..3845612 | - | 1170 | WP_095432089.1 | alanine racemase | - |
QA442_RS19955 (3845727) | 3845727..3846743 | - | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
QA442_RS19960 (3846909) | 3846909..3847274 | - | 366 | WP_069839917.1 | holo-ACP synthase | - |
QA442_RS19965 (3847369) | 3847369..3847968 | + | 600 | WP_095432090.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T276600 WP_003156187.1 NZ_CP121861:c3844041-3843691 [Bacillus stercoris]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|